Gene Rv1907c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Hypothetical protein |
| Comments | Rv1907c, (MTCY180.11), len: 215 aa. Hypothetical unknown protein. Similar to Q50763 Ethyl methane sulphonate resistance protein from Mycobacterium tuberculosis (168 aa), FASTA scores: opt: 638, E(): 0, (69.7% identity in 152 aa overlap). Downstream of a cloned katG gene (EMBL:mtkatg). Differences are due to frameshift errors in the EMBL sequence and the use of an earlier start codon. Alternative nucleotide at position 2153410 (a->G; V158A) has been observed. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2153235 | 2153882 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1907c|Rv1907c
LIGPARRSTTTRRSTPRADRLAGCWCLPGAICQTPRAWWSQARRDGDDETGMRRKGAEMCWMCDHPEATAEEYLDEVYGIMLMHGWAVQHVECERRPFAYTVGLTRRGLPELVVTGLSPRRGQRLLNIAARRALVGDLLTPGMQTTLPAGPLVETVQVTHPDAHLYCAIAIFGDKVTALQLVWADRRGRWPWAADFDEGRGTQPVLGMRATRRSA
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant