Gene Rv1912c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in fatty acid degradation. FADB and FADA are the alpha and beta subunits of the multifunctional enzyme complex of the fatty acid degradation cycle. |
| Product | Possible oxidoreductase FadB5 |
| Comments | Rv1912c, (MTCY180.06), len: 334 aa. Possible fadB5, oxidoreductase, similar to various oxidoreductases: 3-hydroxyacyl-CoA dehydrogenase, quinone oxidoreductases, and polyketide synthases, e.g. NP_104067.1|NC_002678 probable oxidoreductase from Mesorhizobium loti (308 aa); NP_464140.1|NC_003210 protein similar to oxidoreductase from Listeria monocytogenes (313 aa); NP_193889.1|NC_003075 putative NADPH quinone oxidoreductase from Arabidopsis thaliana (325 aa); NP_001880.2|NM_001889 crystallin, zeta; quinone oxidoreductase; NADPH:quinone reductase from Homo sapiens (329 aa); part 2983 to 3197 of T17410 polyketide synthase type I from Streptomyces venezuelae (3739 aa); Q53927|SCBAC20F6.16 hydroxyacyl-CoA dehydrogenase from Streptomyces coelicolor (329 aa), FASTA scores: opt: 621, E(): 2e-30, (39.5% identity in 349 aa overlap); etc. Also similar to many hypothetical Mycobacterium tuberculosis proteins including: MTCY24G1.09, MTCY13D12.11, MTCY19H9.01, MTCY24G1.03, MTCY03A2.17c, etc. Contains quinone oxidoreductase/zeta-crystallin signature (PS01162). |
| Functional category | Lipid metabolism |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2158087 | 2159091 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1912c|fadB5
MRAVVITKHGDPSVLQVRQRPDPPPPGPGQLRVAVRAAGVNFADHLARVGLYPDAPKLPAVVGYEVAGTVEAVGDGVDPNRVGERVLAGTRFGGYCEIVNVAATDSVVLPDALSFEQGAAVPVNYATAWAALHGYGSLRAGERVLIHAAAGGVGIAAVQFAKAAKAEVHGTASPQKHQKLAEFGVDRAIDYRRDGWWQGLGPYDVVLDALGGTSLRRSYTLLRPGGRLVGYGISNMQHGEKRSMRRVAPHALSMLRGFNLMKQLEESKTVIGLNMLRLWDDRRTLEPWIAPLTKALNDGTILPIVHAIVPFAEAPEAHRILAARENVDKVVLVP
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
