Gene Rv1923
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; lipolytic enzyme probably involved in cellular metabolism |
| Product | Probable lipase LipD |
| Comments | Rv1923, (MTCY09F9.41c), len: 446 aa. Probable lipD, hydrolase lipase, similar to esterases and beta-lactamases e.g. G151214 esterase, (389 aa), fasta scores: opt: 569, E(): 5.4e-29, (33.7% identity in 401 aa overlap). Also similar to Mycobacterium tuberculosis hypothetical proteins Rv1497, Rv2463, Rv3775, etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2175173 | 2176513 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1923|lipD
LDVAGLPRLAAGTQAAIIHGMAQPPSLLTTDNGLPFGVQGACDSRFTGVIRAFAGLYPGRKFGGGALSVYIDGRQVVDVWTGWSDRQGKVPWTADTGAMVFSATKGLAATVIHRLVDRGLLSYDAPVAEYWPEFGANGKSEVTVSDVLRHRSGLAHLKGVDKDEVMDHLLMEQKLAAAPLDRQHGKLAYHAVTYGWLLSGLARAVTGKGMRELFREELARPLNTDGIHLGRPPADSPTKAAQTLLPQAKVPTPLLDFIAPKVAGLSFSGLLGAVYFPGILSLLQDDMPFLDGEVPAVNGVVTARALAKTYGALANDGVIDGTRLLSSQAVRGLTGKSELWPDLNLGLPFTYHQGYQSSPVPGLLEGYGHIGLGGTIGWADPETGSAFGYVHNRLLTLLLFDIGSFAGLAALLNSAVVAARRDDPLEVPHFGAPYSEPRHEQAASGA
Bibliography
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Deb C, Daniel J, Sirakova TD, Abomoelak B, Dubey VS and Kolattukudy PE [2006]. A novel lipase belonging to the hormone-sensitive lipase family induced under starvation to utilize stored triacylglycerol in Mycobacterium tuberculosis. Product Transcriptome
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
