Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism
ProductProbable short-chain type dehydrogenase/reductase
CommentsRv1941, (MTCY09F9.23c), len: 256 aa. Probable short-chain dehydrogenase/reductase, similar to various dehydrogenases/reductases, generally belonging to SDR family, e.g. NP_299015.1|NC_002488 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase from Xylella fastidiosa (255 aa); NP_250340.1|NC_002516 probable short-chain dehydrogenase from Pseudomonas aeruginosa (253 aa); NP_106890.1|NC_002678 probable short-chain type dehydrogenase/reductase from Mesorhizobium loti (374 aa) (has its N-terminus longter); P50197|LINC_PSEPA 2,5-dichloro-2,5-cyclohexadiene-1,4-dehydrogenase from Pseudomonas paucimobilis (Sphingomonas paucimobilis) (250 aa), FASTA scores: opt: 529, E(): 5.7e-25, (40.6% identity in 251 aa overlap); etc. Contains PS00061 Short-chain alcohol dehydrogenase family signature. Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis Erdman Rv1936-Rv1941 mutant is more susceptible to ROS-generating compounds; shows reduced growth and persistence in C57BL/6 and iNOS-/- mice but not Phox -/- mice; pathology in infected C57BL/6 mice is reduced; mutant shows growth defect in activated J774A.1 murine, human peripheral blood monocyte-derived, and mouse bone marrow-derived macrophages (BMDM), and BMDM from Phox -/- and iNOS -/- mice (See Cirillo et al., 2009).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS21936642194434+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1941|Rv1941
LNHPDLAGKVAIVTGAGAGIGLAVARRLADEGCHVLCADIDGDAADAAATKIGCGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMFDGALGAGGARSMIARLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTIAALW