Gene Rv1941
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism |
| Product | Probable short-chain type dehydrogenase/reductase |
| Comments | Rv1941, (MTCY09F9.23c), len: 256 aa. Probable short-chain dehydrogenase/reductase, similar to various dehydrogenases/reductases, generally belonging to SDR family, e.g. NP_299015.1|NC_002488 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase from Xylella fastidiosa (255 aa); NP_250340.1|NC_002516 probable short-chain dehydrogenase from Pseudomonas aeruginosa (253 aa); NP_106890.1|NC_002678 probable short-chain type dehydrogenase/reductase from Mesorhizobium loti (374 aa) (has its N-terminus longter); P50197|LINC_PSEPA 2,5-dichloro-2,5-cyclohexadiene-1,4-dehydrogenase from Pseudomonas paucimobilis (Sphingomonas paucimobilis) (250 aa), FASTA scores: opt: 529, E(): 5.7e-25, (40.6% identity in 251 aa overlap); etc. Contains PS00061 Short-chain alcohol dehydrogenase family signature. Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis Erdman Rv1936-Rv1941 mutant is more susceptible to ROS-generating compounds; shows reduced growth and persistence in C57BL/6 and iNOS-/- mice but not Phox -/- mice; pathology in infected C57BL/6 mice is reduced; mutant shows growth defect in activated J774A.1 murine, human peripheral blood monocyte-derived, and mouse bone marrow-derived macrophages (BMDM), and BMDM from Phox -/- and iNOS -/- mice (See Cirillo et al., 2009). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2193664 | 2194434 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1941|Rv1941
LNHPDLAGKVAIVTGAGAGIGLAVARRLADEGCHVLCADIDGDAADAAATKIGCGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMFDGALGAGGARSMIARLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTIAALW
Bibliography
- Cirillo SL et al. [2009]. Protection of Mycobacterium tuberculosis from reactive oxygen species conferred by the mel2 locus impacts persistence and dissemination. Mutant
- de la Paz Santangelo M et al. [2009]. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
