Gene Rv1955
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible toxin HigB |
| Comments | Rv1955, (MTCY09F9.09c), len: 125 aa. Possible higB, toxin, part of toxin-antitoxin (TA) operon with Rv1956 (See Pandey and Gerdes, 2005; Gupta, 2009). Start overlaps another ORF, Rv1954c (MTCY09F9.10). Start changed since first submission (-45 aa). Predicted to be an outer membrane protein (See Song et al., 2008). Upon expression in E. coli has been shown to function as an antitoxin against Rv1956 (PubMed: 19016878); It is not clear if these conflicting results are due to expression in a heterologous system; In various publications, both gene names higA and higB have been assigned to both Rv1955 and Rv1956; we have chosen to call Rv1955 higB after consulting the authors. |
| Functional category | Virulence, detoxification, adaptation |
| Transcriptomics | mRNA identified by DNA microarray analysis: up-regulated at high temperatures, and up-regulated after 24h and 96h of starvation (see citations below). |
| Operon | Rv1954A, Rv1955, Rv1956, and Rv1957 are co-transcribed, by RT-PCR (See Smollett et al., 2009). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Growth of M. tuberculosis H37Rv Rv1955-Rv1957 mutant (gene replacement) is comparable to wild-type (See Fivian-Hughes and Davis, 2010). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2201719 | 2202096 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1955|higB
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLFFRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Bibliography
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Mutant Regulation
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Pandey DP et al. [2005]. Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Homology
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- Gupta A [2009]. Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. Function
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- Smollett KL et al. [2009]. Experimental determination of translational start sites resolves uncertainties in genomic open reading frame predictions - application to Mycobacterium tuberculosis. Operon Proteomics
- Fivian-Hughes AS et al. [2010]. Analyzing the regulatory role of the HigA antitoxin within Mycobacterium tuberculosis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
