Gene Rv1966 (mce3)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown, but thought to be involved in host cell invasion. |
| Product | Mce-family protein Mce3A |
| Comments | Rv1966, (MTV051.04), len: 425 aa. Mce3A; belongs to 24-membered Mycobacterium tuberculosis Mce protein family (see citations below), highly similar to Mycobacterium tuberculosis proteins P72013|MCE1|Rv0169|MTCI28.09|mce1A (454 aa); O07789|MCE2|Rv0589|MTCY19H5.33c|mce2A (404 aa); etc. Also highly similar to others e.g. AAD52105.1|AF113402_1|AF113402 mycobacterial cell entry protein from Mycobacterium bovis BCG (454 aa); NP_302656.1|NC_002677 putative cell invasion protein from Mycobacterium leprae (441 aa); CAC12798.1|AL445327 putative secreted protein from Streptomyces coelicolor (418 aa); etc. Contains a possible N-terminal signal sequence or membrane anchor. Note that previously known as mce3. The transcription of this CDS seems negatively regulated by the product of Rv1963c|mce3R (see Santangelo et al., 2002). Predicted to be an outer membrane protein (See Song et al., 2008). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis H37Rv Rv1966 mutant growth in vitro growth is comparable to wild-type; BALB/c mice survive longer when infected with mutant than with wild-type; lung pathology is reduced or delayed; growth in BALB/c mice is reduced when infection is intratracheal, but comparable to wild-type with intraperitoneal injection (See Gioffre et al., 2005). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2209327 | 2210604 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1966|mce3A
MRRGPGRHRLHDAWWTLILFAVIGVAVLVTAVSFTGSLRSTVPVTLAADRSGLVMDSGAKVMMRGVQVGRVAQIGRIEWAQNGASLRLEIDPDQIRYIPANVEAQISATTAFGAKFVDLVMPQNPSRARLSAGAVLHSKNVSTEINTVFENVVDLLNMIDPLKLNAVLTAVADAVRGQGERIGQATTDLNEVLEALNARGDTIGGNWRSLKNFTDTYDAAAQDILTILNAASTTSATVVNHSTQLDALLLNAIGLSNAGTNLLGSSRDNLVGAADILAPTTSLLFKYNPEYTCFLQGAKWYLDNGGYAAWGGADGRTLQLDVALLFGNDPYVYPDNLPVVAAKGGPGGRPGCGPLPDATHNFPVRQLVTNTGWGTGLDIRPNPGIGHPCWANYFPVTRAVPEPPSIRQCIPGPAIGPNPAAGEQP
Bibliography
- Arruda S, Bomfim G, Knights R, Huima-Byron T and Riley LW [1993]. Cloning of an M. tuberculosis DNA fragment associated with entry and survival inside cells. Sequence
- Cole ST et al. [1998]. Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Sequence Secondary
- Tekaia F et al. [1999]. Analysis of the proteome of Mycobacterium tuberculosis in silico. Secondary
- Santangelo MP et al. [2002]. Negative transcriptional regulation of the mce3 operon in Mycobacterium tuberculosis. Product Function Regulation
- Haile Y et al. [2002]. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). Homolog Function
- Panigada M et al. [2002]. Identification of a promiscuous T-cell epitope in Mycobacterium tuberculosis Mce proteins. Gene
- Gioffré A et al. [2005]. Mutation in mce operons attenuates Mycobacterium tuberculosis virulence. Mutant
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
