Gene Rv1967
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown, but thought to be involved in host cell invasion. |
| Product | Mce-family protein Mce3B |
| Comments | Rv1967, (MTV051.05), len: 342 aa. Mce3B; belongs to 24-membered Mycobacterium tuberculosis Mce protein family (see citations below), highly similar to Mycobacterium tuberculosis proteins O07414|Rv0170|MTCI28.10|mce1B (346 aa); O07788|Rv0590|MTCY19H5.32c|mce2B (275 aa); etc. Also similar to others e.g. NP_302657.1|NC_002677 putative secreted protein from Mycobacterium leprae (346 aa); CAC12797.1|AL445327 putative secreted protein from Streptomyces coelicolor (354 aa); etc. Contains a possible N-terminal signal sequence or membrane anchor. The transcription of this CDS seems negatively regulated by the product of Rv1963c|mce3R (see Santangelo et al., 2002). Predicted to be an outer membrane protein (See Song et al., 2008). |
| Functional category | Virulence, detoxification, adaptation |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2210601 | 2211629 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1967|mce3B
MRENLGGVVVRLGVFLAVCLLTAFLLIAVFGEVRFGDGKTYYAEFANVSNLRTGKLVRIAGVEVGKVTRISINPDATVRVQFTADNSVTLTRGTRAVIRYDNLFGDRYLALEEGAGGLAVLRPGHTIPLARTQPALDLDALIGGFKPLFRALNPEQVNALSEQLLHAFAGQGPTIGSLLAQSAAVTNTLADRDRLIGQVITNLNVVLGSLGAHTDRLDQAVTSLSALIHRLAQRKTDISNAVAYTNAAAGSVADLLSQARAPLAKVVRETDRVAGIAAADHDYLDNLLNTLPDKYQALVRQGMYGDFFAFYLCDVVLKVNGKGGQPVYIKLAGQDSGRCAPK
Bibliography
- Arruda S, Bomfim G, Knights R, Huima-Byron T and Riley LW [1993]. Cloning of an M. tuberculosis DNA fragment associated with entry and survival inside cells. Sequence
- Cole ST et al. [1998]. Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Sequence Secondary
- Tekaia F et al. [1999]. Analysis of the proteome of Mycobacterium tuberculosis in silico. Secondary
- Haile Y et al. [2002]. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). Homolog Function
- Panigada M et al. [2002]. Identification of a promiscuous T-cell epitope in Mycobacterium tuberculosis Mce proteins. Gene
- Santangelo MP et al. [2002]. Negative transcriptional regulation of the mce3 operon in Mycobacterium tuberculosis. Product Function Regulation
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- de la Paz Santangelo M et al. [2009]. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
