Gene Rv1971
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown, but thought involved in host cell invasion. |
| Product | Mce-family protein Mce3F |
| Comments | Rv1971, (MTV051.09), len: 437 aa. Mce3F; belongs to 24-membered Mycobacterium tuberculosis Mce protein family (see citations below), similar to Mycobacterium tuberculosis proteins O07418|Rv0174|MTCI28.14|mce1F (515 aa), O07784|Rv0594|MTCY19H5.28c|mce2F (516 aa); etc. Also highly similar to others e.g. NP_302661.1|NC_002677 putative secreted protein from Mycobacterium leprae (516 aa); CAC12793.1|AL445327 putative secreted protein from Streptomyces coelicolor (433 aa); etc. Contains a possible N-terminal signal sequence or membrane anchor. The transcription of this CDS seems negatively regulated by the product of Rv1963c|mce3R (see Santangelo et al., 2002). Predicted to be an outer membrane protein (See Song et al., 2008). |
| Functional category | - |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2215257 | 2216570 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1971|mce3F
MLHLPRRVIVQLAVFTVIAVGVLAITFLHFVRLPAMLFGVGRYTVTMELVEAGGLYRTGNVTYRGFEVGRVAAVRLTDTGVQAVLALKSGIDIPSDLKAEVHSHTAIGETYVELLPRNAASPPLKNGDVIALADTSVPPDINDLLSAANTALEAIPHENLQTVIDESYTAVAGLGLELSRLIKGSAELAIDARANLDPLVALIDRAGPVLDSQTHTSDAIAAWAAQLAAVTGQLQTHDSAVGDLIDRGGPALGETRQLLERLQPTVPILLANLVSVGQVALTYHNDIEQLLVVFPMAIAAEQAGILANLNTKQAYRGQYLSFNLNLNLPPPCTTGFLPAQQRRIPTFEDYPDRPAGDLYCRVPQDSPFNVRGARNIPCETVPGKRAPTVKLCESDAPYLPLNDGYNWKGDPNATVPGLGSGQDIPQTWQTMLLPPGS
Bibliography
- Arruda S, Bomfim G, Knights R, Huima-Byron T and Riley LW [1993]. Cloning of an M. tuberculosis DNA fragment associated with entry and survival inside cells. Sequence
- Cole ST et al. [1998]. Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Sequence Secondary
- Tekaia F et al. [1999]. Analysis of the proteome of Mycobacterium tuberculosis in silico. Secondary
- Panigada M et al. [2002]. Identification of a promiscuous T-cell epitope in Mycobacterium tuberculosis Mce proteins. Gene
- Haile Y et al. [2002]. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). Homolog Function
- Santangelo MP et al. [2002]. Negative transcriptional regulation of the mce3 operon in Mycobacterium tuberculosis. Product Function Regulation
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- de la Paz Santangelo M et al. [2009]. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant