Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown, but thought involved in host cell invasion.
ProductMce-family protein Mce3F
CommentsRv1971, (MTV051.09), len: 437 aa. Mce3F; belongs to 24-membered Mycobacterium tuberculosis Mce protein family (see citations below), similar to Mycobacterium tuberculosis proteins O07418|Rv0174|MTCI28.14|mce1F (515 aa), O07784|Rv0594|MTCY19H5.28c|mce2F (516 aa); etc. Also highly similar to others e.g. NP_302661.1|NC_002677 putative secreted protein from Mycobacterium leprae (516 aa); CAC12793.1|AL445327 putative secreted protein from Streptomyces coelicolor (433 aa); etc. Contains a possible N-terminal signal sequence or membrane anchor. The transcription of this CDS seems negatively regulated by the product of Rv1963c|mce3R (see Santangelo et al., 2002). Predicted to be an outer membrane protein (See Song et al., 2008).
Functional category-
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS22152572216570+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1971|mce3F
MLHLPRRVIVQLAVFTVIAVGVLAITFLHFVRLPAMLFGVGRYTVTMELVEAGGLYRTGNVTYRGFEVGRVAAVRLTDTGVQAVLALKSGIDIPSDLKAEVHSHTAIGETYVELLPRNAASPPLKNGDVIALADTSVPPDINDLLSAANTALEAIPHENLQTVIDESYTAVAGLGLELSRLIKGSAELAIDARANLDPLVALIDRAGPVLDSQTHTSDAIAAWAAQLAAVTGQLQTHDSAVGDLIDRGGPALGETRQLLERLQPTVPILLANLVSVGQVALTYHNDIEQLLVVFPMAIAAEQAGILANLNTKQAYRGQYLSFNLNLNLPPPCTTGFLPAQQRRIPTFEDYPDRPAGDLYCRVPQDSPFNVRGARNIPCETVPGKRAPTVKLCESDAPYLPLNDGYNWKGDPNATVPGLGSGQDIPQTWQTMLLPPGS
      
Bibliography