Gene Rv1986
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown; possibly involved in transport of lysine across the membrane. |
| Product | Probable conserved integral membrane protein |
| Comments | Rv1986, (MTCY39.33c), len: 199 aa. Probable conserved integral membrane protein, LysE family possibly involved in transport of Lysine, similar to P11667|YGGA_ECOLI hypothetical 23.2 kDa protein in sbm-fba intergenic region (211 aa), FASTA scores: opt: 379, E(): 1.5e-19, (37.3% identity in 185 aa overlap); and Q11154|Rv0488 hypothetical 20.9 kDa protein from M. tuberculosis (201 aa), FASTA scores: opt: 784, E(): 0, (63.4% identity in 186 aa overlap). Belongs to the LYSE/YGGA family. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2230011 | 2230610 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1986|Rv1986
VNSPLVVGFLACFTLIAAIGAQNAFVLRQGIQREHVLPVVALCTVSDIVLIAAGIAGFGALIGAHPRALNVVKFGGAAFLIGYGLLAARRAWRPVALIPSGATPVRLAEVLVTCAAFTFLNPHVYLDTVVLLGALANEHSDQRWLFGLGAVTASAVWFATLGFGAGRLRGLFTNPGSWRILDGLIAVMMVALGISLTVT
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
