Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown; possibly involved in transport of lysine across the membrane.
ProductProbable conserved integral membrane protein
CommentsRv1986, (MTCY39.33c), len: 199 aa. Probable conserved integral membrane protein, LysE family possibly involved in transport of Lysine, similar to P11667|YGGA_ECOLI hypothetical 23.2 kDa protein in sbm-fba intergenic region (211 aa), FASTA scores: opt: 379, E(): 1.5e-19, (37.3% identity in 185 aa overlap); and Q11154|Rv0488 hypothetical 20.9 kDa protein from M. tuberculosis (201 aa), FASTA scores: opt: 784, E(): 0, (63.4% identity in 186 aa overlap). Belongs to the LYSE/YGGA family.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS22300112230610+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1986|Rv1986
VNSPLVVGFLACFTLIAAIGAQNAFVLRQGIQREHVLPVVALCTVSDIVLIAAGIAGFGALIGAHPRALNVVKFGGAAFLIGYGLLAARRAWRPVALIPSGATPVRLAEVLVTCAAFTFLNPHVYLDTVVLLGALANEHSDQRWLFGLGAVTASAVWFATLGFGAGRLRGLFTNPGSWRILDGLIAVMMVALGISLTVT