Gene Rv2023A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Hypothetical protein, pseudogene |
| Comments | Rv2023A, len: 152 aa. Hypothetical unknown protein (pseudogene), equivalent to the C-terminus of Q8VJS0|MT2080 hypothetical protein from Mycobacterium tuberculosis strain CDC1551 (225 aa), FASTA scores: opt: 1028, E(): 3.6e-66, (99.342% identity in 152 aa overlap) and C-terminus of Mb2047c hypothetical protein from Mycobacterium bovis (225 aa). And N-terminal part equivalent to the C-terminus of Q9XB17 hypothetical 15.5 kDa protein from Mycobacterium bovis BCG (131 aa), FASTA scores: opt: 409, E(): 4.2e-22, (98.276% identity in 58 aa overlap). Note that a deletion of DNA (RvD1 region) in Mycobacterium tuberculosis strain H37Rv resulted in a truncated CDS comparatively to Mycobacterium bovis or Mycobacterium tuberculosis strain CDC1551 genomes (see citations below). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2268268 | 2268726 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2023A|Rv2023A
VFEFFTQNTSVGQNANYYNCTVYKVPLIGSILYQFHWRRPIHSHMMHAQDRRPVTQLPTYDDHAQTKPLNEMPVDFAKEIVRLWRVFVKDLNNHTNLQFRPIGATAQTALASEINAAKRVRTNDVTQRQIAVGKETSRLEPNFSIPQIEWPA
Bibliography
- Gordon SV et al. [1999]. Identification of variable regions in the genomes of tubercle bacilli using bacterial artificial chromosome arrays. Secondary Sequence
- Brosch R et al. [1999]. Genomic analysis reveals variation between Mycobacterium tuberculosis H37Rv and the attenuated M. tuberculosis H37Ra strain. Sequence
