Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductConserved hypothetical protein
CommentsRv2083, (MTCY49.22), len: 314 aa. Conserved hypothetical protein. Similar to many e.g. Mycobacterium tuberculosis Rv3898c (110 aa) and Rv3897c (210 aa).
Functional categoryConserved hypotheticals
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS23408712341815+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2083|Rv2083
MTSIESHPEQYWAAAGRPGPVPLALGPVHPGGPTLIDLLMALFGLSTNADLGGANADIEGDDTDRRAHAADAARKFSANEANAAEQMQGVGAQGMAQMASGIGGALSGALGGVMGPLTQLPQQAMQAGQGAMQPLMSAMQQAQGADGLAAVDGARLLDSIGGEPGLGSGAGGGDVGGGGAGGTTPTGYLGPPPVPTSSPPTTPAGAPTKSATMPPPGGASPASAHMGAAGMPMVPPGAMGARGEGSGQEKPVEKRLTAPAVPNGQPVKGRLTVPPSAPTTKPTDGKPVVRRRILLPEHKDFGRIAPDEKTDAGE