Gene Rv2105
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Required for the transposition of the insertion element IS6110. |
| Product | Putative transposase for insertion sequence element IS6110 (fragment) |
| Comments | Rv2105, (MTCY261.01), len: 108 aa. Putative transposase for IS6110 (fragment), identical to many other Mycobacterium tuberculosis IS6110 transposase subunits e.g. Q50686|YIA4_MYCTU Insertion element IS6110 hypothetical 12.0 kDa protein (108 aa), fasta scores: E(): 1.4e-43, (100.00% identity in 108 aa overlap). The transposase described here may be made by a frame shifting mechanism during translation that fuses Rv2105 and Rv2106, the sequence UUUUAAAG (directly upstream of Rv2106) maybe responsible for such a frameshifting event (see McAdam et al., 1990). |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2365465 | 2365791 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2105|Rv2105
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASAFFAAELDRPAR
Bibliography
- Thierry D et al. [1990]. Characterization of a Mycobacterium tuberculosis insertion sequence, IS6110, and its application in diagnosis. Sequence
- McAdam RA, Hermans PW, van Soolingen D, Zainuddin ZF, Catty D, van Embden JD and Dale JW [1990]. Characterization of a Mycobacterium tuberculosis insertion sequence belonging to the IS3 family. Sequence
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
