Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCan dephosphorylate a broad range of substrates. Likely involved in sulfur metabolism, controlling the pool of 3'-phosphoadenosine 5'-phosphate (pap) and 3'-phosphoadenoside 5'-phosphosulfate (PAPS) [catalytic activity: adenosine 3',5'-bisphosphate + H2O = adenosine 5'-phosphate + phosphate]. Has also been shown to have myo-inositol 1-phosphatase [catalytic activity: myo-inositol 1-phosphate + H(2)O = myo-inositol + phosphate] and fructose 1,6-bisphosphatase [catalytic activity: D-fructose 1,6-bisphosphate + H2O = D-fructose 6-phosphate + phosphate] activities.
ProductMonophosphatase CysQ
CommentsRv2131c, (MTCY270.37), len: 267 aa. CysQ, monophosphatase, equivalent to CYSQ_MYCLE|P46726 cysQ protein homolog from Mycobacterium leprae (289 aa), FASTA scores: opt: 1374, E(): 0, (77.3% identity in 264 aa overlap). Contains inositol monophosphatase family signature 1 (PS00629), significance uncertain. Seems to belong to the inositol monophosphatase family. Cofactor: Mg2+. Inhibited by Li+; PAPase activity is inhibited by Na+ and K+, but IMPase activity is not (See Gu et al., 2006; Hatzios et al., 2008).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis H37Rv cysQ|Rv2131c could only be deleted after integration of a second copy of the gene, indicating cysQ is essential; alternatively, deletion mutants could be isolated in the presence of inositol if M. tuberculosis was expressing M. smegmatis porin mspA - this mutant was still able to grow when inositol and mspA were removed, indicating cysQ is not essential (See Movahedzadeh et al., 2010).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS23925172393320-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2131c|cysQ
VVSPAAPDLTDDLTDAELAADLAADAGKLLLQVRAEIGFDQPWTLGEAGDRQANSLLLRRLQAERPGDAVLSEEAHDDLARLKSDRVWIIDPLDGTREFSTPGRDDWAVHIALWRRSSNGQPEITDAAVALPARGNVVYRTDTVTSGAAPAGVPGTLRIAVSATRPPAVLHRIRQTLAIQPVSIGSAGAKAMAVIDGYVDAYLHAGGQWEWDSAAPAGVMLAAGMHASRLDGSPLRYNQLDPYLPDLLMCRAEVAPILLGAIADAWR