Gene Rv2131c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Can dephosphorylate a broad range of substrates. Likely involved in sulfur metabolism, controlling the pool of 3'-phosphoadenosine 5'-phosphate (pap) and 3'-phosphoadenoside 5'-phosphosulfate (PAPS) [catalytic activity: adenosine 3',5'-bisphosphate + H2O = adenosine 5'-phosphate + phosphate]. Has also been shown to have myo-inositol 1-phosphatase [catalytic activity: myo-inositol 1-phosphate + H(2)O = myo-inositol + phosphate] and fructose 1,6-bisphosphatase [catalytic activity: D-fructose 1,6-bisphosphate + H2O = D-fructose 6-phosphate + phosphate] activities. |
| Product | Monophosphatase CysQ |
| Comments | Rv2131c, (MTCY270.37), len: 267 aa. CysQ, monophosphatase, equivalent to CYSQ_MYCLE|P46726 cysQ protein homolog from Mycobacterium leprae (289 aa), FASTA scores: opt: 1374, E(): 0, (77.3% identity in 264 aa overlap). Contains inositol monophosphatase family signature 1 (PS00629), significance uncertain. Seems to belong to the inositol monophosphatase family. Cofactor: Mg2+. Inhibited by Li+; PAPase activity is inhibited by Na+ and K+, but IMPase activity is not (See Gu et al., 2006; Hatzios et al., 2008). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis H37Rv cysQ|Rv2131c could only be deleted after integration of a second copy of the gene, indicating cysQ is essential; alternatively, deletion mutants could be isolated in the presence of inositol if M. tuberculosis was expressing M. smegmatis porin mspA - this mutant was still able to grow when inositol and mspA were removed, indicating cysQ is not essential (See Movahedzadeh et al., 2010). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2392517 | 2393320 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2131c|cysQ
VVSPAAPDLTDDLTDAELAADLAADAGKLLLQVRAEIGFDQPWTLGEAGDRQANSLLLRRLQAERPGDAVLSEEAHDDLARLKSDRVWIIDPLDGTREFSTPGRDDWAVHIALWRRSSNGQPEITDAAVALPARGNVVYRTDTVTSGAAPAGVPGTLRIAVSATRPPAVLHRIRQTLAIQPVSIGSAGAKAMAVIDGYVDAYLHAGGQWEWDSAAPAGVMLAAGMHASRLDGSPLRYNQLDPYLPDLLMCRAEVAPILLGAIADAWR
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Gu X et al. [2006]. Rv2131c gene product: an unconventional enzyme that is both inositol monophosphatase and fructose-1,6-bisphosphatase. Biochemistry Function
- Hatzios SK et al. [2008]. Rv2131c from Mycobacterium tuberculosis is a CysQ 3'-phosphoadenosine-5'-phosphatase. Biochemistry Function
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Movahedzadeh F et al. [2010]. Inositol monophosphate phosphatase genes of Mycobacterium tuberculosis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant