Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductConserved hypothetical protein
CommentsRv2133c, (MTCY270.35), len: 262 aa. Conserved hypothetical protein. Function: unknown but equivalent to hypothetical Mycobacterium leprae protein, Q49774. FASTA best: Q49774 B2126_C1_150 (262 aa) opt: 1447, E(): 0; (79.0% identity in 262 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS23938512394639-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2133c|Rv2133c
VLADGELTVLGRIRSASNATFLCESTLGLRSLHCVYKPVSGERPLWDFPDGTLAGRELSAYLVSTQLGWNLVPHTIIRDGPAGIGMLQLWVQQPGDAVDSDPLPGPDLVDLFPAHRPRPGYLPVLRAYDYAGDEVVLMHADDIRLRRMAVFDVLINNADRKGGHILCGIDGQVYGVDHGLCLHVENKLRTVLWGWAGKPIDDQILQAVAGLADALGGPLAEALAGRIAAAEIGALRRRAQSLLDQPVMPGPNGHRPIPWPAF