Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved lipoprotein LppL
CommentsRv2138, (MTCY270.30c), len: 358 aa. Probable lppL, conserved lipoprotein, with appropriately placed lipoprotein signature (PS00013) strongly similar to hypothetical Mycobacterium leprae protein, Q49806. FASTA best: Q49806 B2126_F3_142. (298 aa) opt: 1495, E(): 0; (75.3% identity in 300 aa overlap).
Functional categoryCell wall and cell processes
ProteomicsPutative glycoprotein identified by LC/ESI-MS/MS in the culture filtrate of M. tuberculosis H37Rv (See Gonzalez-Zamorano et al., 2009). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS23973302398406+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2138|lppL
LLTGNKPAVQRRFIGLLMLSVLVAGCSSNPLANFAPGYPPTIEPAQPAVSPPTSQDPAGAVRPLSGHPRAALFDNGTRQLVALRPGADSAAPASIMVFDDVHVAPRVIFLPGPAAALTSDDHGTAFLAARGGYFVADLSSGHTARVNVADAAHTDFTAIARRSDGKLVLGSADGAVYTLAKNPAVDPASGAATVASRTKIFARVDALVTQGNTTVVLDRGQTSVTTIGADGHAQQALRAGQGATTMAADPLGRVLIADTRGGQLLVYGVDPLILRQAYPVRQAPYGLAGSRELAWVSQTASNTVIGYDLTTGIPVEKVRYPTVQQPNSLAFDETSDTLYVVSGSGAGVQVIEHAAGTR