Gene Rv2138
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved lipoprotein LppL |
| Comments | Rv2138, (MTCY270.30c), len: 358 aa. Probable lppL, conserved lipoprotein, with appropriately placed lipoprotein signature (PS00013) strongly similar to hypothetical Mycobacterium leprae protein, Q49806. FASTA best: Q49806 B2126_F3_142. (298 aa) opt: 1495, E(): 0; (75.3% identity in 300 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Putative glycoprotein identified by LC/ESI-MS/MS in the culture filtrate of M. tuberculosis H37Rv (See Gonzalez-Zamorano et al., 2009). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2397330 | 2398406 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2138|lppL
LLTGNKPAVQRRFIGLLMLSVLVAGCSSNPLANFAPGYPPTIEPAQPAVSPPTSQDPAGAVRPLSGHPRAALFDNGTRQLVALRPGADSAAPASIMVFDDVHVAPRVIFLPGPAAALTSDDHGTAFLAARGGYFVADLSSGHTARVNVADAAHTDFTAIARRSDGKLVLGSADGAVYTLAKNPAVDPASGAATVASRTKIFARVDALVTQGNTTVVLDRGQTSVTTIGADGHAQQALRAGQGATTMAADPLGRVLIADTRGGQLLVYGVDPLILRQAYPVRQAPYGLAGSRELAWVSQTASNTVIGYDLTTGIPVEKVRYPTVQQPNSLAFDETSDTLYVVSGSGAGVQVIEHAAGTR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- González-Zamorano M et al. [2009]. Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
