Gene Rv2168c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Required for the transposition of the insertion element IS6110. |
Product | Putative transposase for insertion sequence element IS6110 (fragment) |
Comments | Rv2168c, (MTV021.01c), len: 108 aa. Putative transposase for IS6110 (fragment), identical to many other Mycobacterium tuberculosis IS6110 transposase subunits e.g. Q50686|YIA4_MYCTU Insertion element IS6110 hypothetical 12.0 kDa protein (108 aa), fasta scores: E(): 1.4e-43, (100.00% identity in 108 aa overlap). The transposase described here may be made by a frame shifting mechanism during translation that fuses Rv2167c and Rv2168c, the sequence UUUUAAAG (directly upstream of Rv2167c) maybe responsible for such a frameshifting event (see McAdam et al., 1990). |
Functional category | Insertion seqs and phages |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2431094 | 2431420 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2168c|Rv2168c MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASAFFAAELDRPAR
Bibliography
- Thierry D et al. [1990]. Characterization of a Mycobacterium tuberculosis insertion sequence, IS6110, and its application in diagnosis. Sequence
- McAdam RA, Hermans PW, van Soolingen D, Zainuddin ZF, Catty D, van Embden JD and Dale JW [1990]. Characterization of a Mycobacterium tuberculosis insertion sequence belonging to the IS3 family. Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant