Gene Rv2177c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Required for the transposition of an insertion element, possibly IS1558. |
| Product | Possible transposase |
| Comments | Rv2177c, (MTV021.10c), len: 221 aa. Possible IS1558 transposase (see citation below), similar to several is element proteins and transposases but nearly identical to last 221 residues of MTCY428_23 (333 aa). FASTA scores: Z81451|MTCY428_23 Mycobacterium tuberculosis cosmid (333 aa) opt: 1491, E() : 0; 98.6% identity in 221 aa overlap. |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2439282 | 2439947 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2177c|Rv2177c
MRSKIPDLQRALEGRFDDHHALMCRLHLAHLDQLDAMIGALDEQIEQLMHPFCARRELIASIPGIGVGASATVISEIGADPAAWFPSAEHLASWVRLCPGNHESAGKRHHGARRTGNQHLQPVLVECAWAAVRTDGYLREYYRRQVRKFGGFRSPAANKKAIIAVAHKLIVIIWHVLATGRPYQDLGADYFTTRMDPDKERRRLVAKLEAQGLGVTLEPAA
Bibliography
- Gordon SV et al. [1999]. New insertion sequences and a novel repeated sequence in the genome of Mycobacterium tuberculosis H37Rv. Sequence
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
