Gene Rv2190c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2190c, (MTV021.23c, MTCY190.01c), len: 385 aa. Conserved hypothetical protein; similar to other hypothetical mycobacterial proteins, including Rv1477, Rv1478, Rv1566c, Rv0024, that are similar to protein p60 precursors from Listeria e.g. Q018 38|P60_LISSE protein p60 precursor (invasion-associated protein) (524 aa). FASTA scores: gp|Z80233|MTCY10H4_25 (281 aa) opt: 290, E(): 6.9e-05; 37.0% identity in 127 aa overlap and sp|Q01838|P60_LISSE protein P60 precursor (523 aa) opt: 268, E(): 0.00071; 38.5% identity in 104 aa overlap. |
| Functional category | Virulence, detoxification, adaptation |
| Proteomics | Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted and cleavable signal sequence confirmed experimentally (See Malen et al., 2007). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2452115 | 2453272 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2190c|Rv2190c
LRLDQRWLIARVIMRSAIGFFASFTVSSGVLAANVLADPADDALAKLNELSRQAEQTTEALHSAQLDLNEKLAAQRAADQKLADNRTALDAARARLATFQTAVNKVAAATYMGGRTHGMDAILTAESPQLLIDRLSVQRVMAHQMSTQMARFKAAGEQAVKAEQAAAKSAADARSAAEQAAAVRANLQHKQSQLQVQIAVVKSQYVALTPEERTALADPGPVPAVAAIAPGAPPAALPPGAPPGDGPAPGVAPPPGGMPGLPFVQPDGAGGDRTAVVQAALTQVGAPYAWGGAAPGGFDCSGLVMWAFQQAGIALPHSSQALAHGGQPVALSDLQPGDVLTFYSDASHAGIYIGDGLMVHSSTYGVPVRVVPMDSSGPIYDARRY
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant