Gene Rv2252
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Unknown. Involved in synthesis of phosphatidylinositol mannosides (PIMS). |
Product | Diacylglycerol kinase |
Comments | Rv2252, (MTV022.02), len: 309 aa. Diacylglycerol kinase (See Owens et al., 2006), similar to hypothetical proteins from Bacillus subtilis (e.g. BSUB0004_120), Streptomyces coelicolor A3(2) >emb|CAB61184.1| (AL132973) hypothetical protein SCF91.27c (293 aa) and P39074. FASTA scores: Z99107|BSUB0004_120 Bacillus subtilis complete genome (303 aa) opt: 397, E(): 1.7e-19; (26.4% identity in 299 aa overlap) and P390 74|BMRU_BACSU BMRU protein (297 aa) opt: 309, E(): 1.3e-13; (25.0% identity in 284 aa overlap). |
Functional category | Lipid metabolism |
Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Levels of diacyl-PIM2 and diacyl-PIM6 are reduced in CDC1551 Rv2252 mutant (See Owens et al., 2006). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2526989 | 2527918 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2252|Rv2252 MSAGQLRRHEIGKVTALTNPLSGHGAAVKAAHGAIARLKHRGVDVVEIVGGDAHDARHLLAAAVAKGTDAVMVTGGDGVVSNALQVLAGTDIPLGIIPAGTGNDHAREFGLPTKNPKAAADIVVDGWTETIDLGRIQDDNGIEKWFGTVAATGFDSLVNDRANRMRWPHGRMRYYIAMLAELSRLRPLPFRLVLDGTEEIVADLTLADFGNTRSYGGGLLICPNADHSDGLLDITMAQSDSRTKLLRLFPTIFKGAHVELDEVSTTRAKTVHVECPGINVYADGDFACPLPAEISAVPAALQVLRPRHG
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Owens RM et al. [2006]. M. tuberculosis Rv2252 encodes a diacylglycerol kinase involved in the biosynthesis of phosphatidylinositol mannosides (PIMs). Function Mutant Product
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant