Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown. Involved in synthesis of phosphatidylinositol mannosides (PIMS).
ProductDiacylglycerol kinase
CommentsRv2252, (MTV022.02), len: 309 aa. Diacylglycerol kinase (See Owens et al., 2006), similar to hypothetical proteins from Bacillus subtilis (e.g. BSUB0004_120), Streptomyces coelicolor A3(2) >emb|CAB61184.1| (AL132973) hypothetical protein SCF91.27c (293 aa) and P39074. FASTA scores: Z99107|BSUB0004_120 Bacillus subtilis complete genome (303 aa) opt: 397, E(): 1.7e-19; (26.4% identity in 299 aa overlap) and P390 74|BMRU_BACSU BMRU protein (297 aa) opt: 309, E(): 1.3e-13; (25.0% identity in 284 aa overlap).
Functional categoryLipid metabolism
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Levels of diacyl-PIM2 and diacyl-PIM6 are reduced in CDC1551 Rv2252 mutant (See Owens et al., 2006).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS25269892527918+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2252|Rv2252
MSAGQLRRHEIGKVTALTNPLSGHGAAVKAAHGAIARLKHRGVDVVEIVGGDAHDARHLLAAAVAKGTDAVMVTGGDGVVSNALQVLAGTDIPLGIIPAGTGNDHAREFGLPTKNPKAAADIVVDGWTETIDLGRIQDDNGIEKWFGTVAATGFDSLVNDRANRMRWPHGRMRYYIAMLAELSRLRPLPFRLVLDGTEEIVADLTLADFGNTRSYGGGLLICPNADHSDGLLDITMAQSDSRTKLLRLFPTIFKGAHVELDEVSTTRAKTVHVECPGINVYADGDFACPLPAEISAVPAALQVLRPRHG