Gene Rv2256c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2256c, (MTV022.06c), len: 177 aa. Conserved hypothetical protein, similar to Streptomyces glaucescens ORF5 (164 aa) and Streptomyces coelicolor hypothetical protein SC4A7.19c (164 aa; emb|CAB62723.1|AL133423). FASTA scores: sptr|Q54209|Q54209 FABD, FABH, FABC, FABB, and ORF5 (164 aa) opt: 504, E(): 3.9e-27; (44.4% identity in 162 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2529341 | 2529874 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2256c|Rv2256c
VEPKEQQMRASNQFADVTSGVVYIHASPAAVCPHVEWALSSTLQAKANLVWTPQPALPPQLRAVTNWVGPVGTGARLANALRSWSVLRFEVTEDPSPGVDGQRFSHTPQLGLWSGAMSANGDIMVGEMRLRAMMAQGADTLAAELDSVLGTAWDQALEVYRDGGDAGEVTWLSRGVG
Bibliography
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
