Gene Rv2260
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2260, (MTV022.10), len: 211 aa. Conserved hypothetical protein, similar to hypothetical proteins Rv0634c, Rv1637c, Rv3677c, Rv2581c from Mycobacterium tuberculosis and to various hydrolases. FASTA scores: sptr|O06154|O06154 hypothetical 21.3 kDa protein (200 aa) opt: 355, E(): 4e- 15; (37.4% identity in 198 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2533330 | 2533965 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2260|Rv2260
MAAIERVITHGTFELDGGSWEVDNNIWLVGDDSEVVVFDAAHHAAPIIDAVGGRKVVAVICTHGHNDHVTVAPELGTALDAPVLMHPGDAVLWRMTHPDKSFRAVSDGDAVRVGGTELRALHTPGHSPGSVCWYAPELGPGTGTVFSGDTLFAGGPGATGRSYSDFPTILRSISGRLGALPGDTVVHTGHGDSTTIGDEIVHYEEWVARGH
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
