Gene Rv2267c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2267c, (MTCY339.43), len: 388 aa. Conserved hypothetical protein; some similarity to Mycobacterium tuberculosis Rv3529c; gp|Z82098|MTCY3C7_27 (384 aa) FASTA score: opt: 261, E(): 3.6e-10; 27.3% identity in 253 aa overlap. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Conserved hypotheticals |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2541644 | 2542810 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2267c|Rv2267c
MKALRSSSRLSRWREWAAPLWVGCNFSAWMRLLIRNRFAVHHSRWHFAVLYTFLSMVNSCLGLWQKIVFGRRVAETVIADPPIFIVGHWRTGTTLLHELLVVDDRHTGPTGYECLAPHHFLLTEWFAPYVEFLVSKHRAMDNMDLSLHHPQEDEFVWCMQGLPSPYLTIAFPNRPPQYEEYLDLEQVAPRELEIWKRTLFRFVQQVYFRRRKTVILKNPTHSFRIKVLLEVFPQAKFIHIVRDPYVVYPSTIHLHKALYRIHGLQQPTFDGLDDKVVSTYVDLYRKLDEGRELVDPTRFYELRYEDLIGDPEGQLRRLYQHLGLGDFECYLPRLRQYLADHADYKTNSYQLTVEQRAIVDEHWGEIIDRYGYDRHTPEPARLRPAVGG
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant