Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductConserved hypothetical protein
CommentsRv2267c, (MTCY339.43), len: 388 aa. Conserved hypothetical protein; some similarity to Mycobacterium tuberculosis Rv3529c; gp|Z82098|MTCY3C7_27 (384 aa) FASTA score: opt: 261, E(): 3.6e-10; 27.3% identity in 253 aa overlap. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryConserved hypotheticals
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS25416442542810-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2267c|Rv2267c
MKALRSSSRLSRWREWAAPLWVGCNFSAWMRLLIRNRFAVHHSRWHFAVLYTFLSMVNSCLGLWQKIVFGRRVAETVIADPPIFIVGHWRTGTTLLHELLVVDDRHTGPTGYECLAPHHFLLTEWFAPYVEFLVSKHRAMDNMDLSLHHPQEDEFVWCMQGLPSPYLTIAFPNRPPQYEEYLDLEQVAPRELEIWKRTLFRFVQQVYFRRRKTVILKNPTHSFRIKVLLEVFPQAKFIHIVRDPYVVYPSTIHLHKALYRIHGLQQPTFDGLDDKVVSTYVDLYRKLDEGRELVDPTRFYELRYEDLIGDPEGQLRRLYQHLGLGDFECYLPRLRQYLADHADYKTNSYQLTVEQRAIVDEHWGEIIDRYGYDRHTPEPARLRPAVGG