Gene Rv2293c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2293c, (MTCY339.17), len: 246 aa. Conserved hypothetical protein; some similarity to hypothetical protein (299 aa) AAK24237.1| (AE005897) belonging to phosphorylase family [Caulobacter crescentus] (33% identity in 131 aa overlap). Possible lipoprotein: signal peptide at N-terminus |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 and 90 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2564292 | 2565032 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2293c|Rv2293c
VGAPLRHCLLVAAALSLGCGVAAADPGYVANVIPCEQRTLVLSAFPAEADAVLAHTALDANPVVVADRRRYYLGSISGKKVIVAMTGIGLVNATNTTETAFARFTCASSIAIAAVMFSGVAGGAGRTSIGDVAIPARWTLDNGATFRGVDPGMLATAQTLSVVLDNINTLGNPVCLCRNVPVVRLNHLGRQPQLFVGGDGSSSDKNNGQAFPCIPNGGSVFAANPVVHPIAHLAIPVTFSRRRDPG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
