Gene Rv2295
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2295, (MTCY339.15c), len: 212 aa. Conserved hypothetical protein, cysteine-rich protein, similar to YIEJ_ECOLI P31469 hypothetical 22.5 kDa protein in tnab-bglb intergenic region (195 aa), opt: 270, E(): 3.4e-11, (36.4% identity in 198 aa overlap). Alternative start suggested by similarity 26 codons further downstream |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2566772 | 2567410 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2295|Rv2295
MDQSANHACLPTPLASTTGRGQDHEMPVEETSTPQKLPQFRYHPDPVGTGSIVADEVSCVSCEQRRPYTYTGPVYAEEELNEAICPWCIADGSAASRFDATFTDAMWAVPDDVPEDVTEEVLCRTPGFTGWLQEEWLHHCGDAAAFLGPVGASEVADLPDALDALRNEYRGYDWPADKIEEFILTLDRNGLATAYLFRCLSCGVHLAYADFA
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
