Gene Rv2298 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Conserved protein | 
| Comments | Rv2298, (MTCY339.12c), len: 323 aa. Conserved protein. Similar to SLR0545 Synechocystis sp, Q55493 hypothetical 34.6 kDa protein (314 aa), FASTA scores, opt: 427, E(): 1.7e-20, (39.3% identity in 303 aa overlap) and to YZAE_BACSU P46905 hypothetical protein in natb 3'region (268 aa) FASTA scores, opt: 370, E(): 6.1e-17, (31.4% identity in 264 aa overlap) | 
| Functional category | Conserved hypotheticals | 
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell wall and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). | 
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 2569082 | 2570053 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv2298|Rv2298
MKYLDVDGIGQVSRIGLGTWQFGSREWGYGDRYATGAARDIVKRARALGVTLFDTAEIYGLGKSERILGEALGDDRTEVVVASKVFPVAPFPAVIKNRERASARRLQLNRIPLYQIHQPNPVVPDSVIMPGMRDLLDSGDIGAAGVSNYSLARWRKADAALGRPVVSNQVHFSLAHPDALEDLVPFAELENRIVIAYSPLAQGLLGGKYGLENRPGGVRALNPLFGTENLRRIEPLLATLRAIAVDVDAKPAQVALAWLISLPGVVAIPGASSVEQLEFNVAAADIELSAQSRDALTDAARAFRPVSTGRFLTDMVREKVSRR
      
    Bibliography
    - Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant