Gene Rv2301 (cfp25, culp2, clp2)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Hydrolysis of cutin (a polyester that forms the structure of plant cuticle). |
| Product | Probable cutinase Cut2 |
| Comments | Rv2301, (MTCY339.08c), len: 230 aa. Probable cut2 (alternate gene name: cfp25), cutinase, highly similar to others from Mycobacteria tuberculosis e.g. MTCY13E12.04|Rv3451|O06318|CUT3_MYCTU (247 aa), FASTA scores: opt: 569, E(): 2.3e-27, (45.3% identity in 223 aa overlap); MT2037|MTCY39.35|RV1984C|Q10837|CUT1_MYCTU (217 aa), FASTA scores: opt: 383, E(): 3.4e-16 (42.9% identity in 217 aa overlap); O69691|Rv3724|MTV025.072 putative cutinase precursor (187 aa), FASTA scores: opt: 248, E(): 4.3e-08, (41.85% identity in 172 aa overlap); etc. Also similar to few others from other organisms e.g. Q9KK87 serine esterase cutinase from Mycobacterium avium (220 aa), FASTA scores: opt: 391, E(): 1.1e-16, (39.15% identity in 235 aa overlap); etc. Contains PS00095 C-5 cytosine-specific DNA methylases C-terminal signature. Belongs to the cutinase family. Start changed since first submission (+11 aa). |
| Functional category | Cell wall and cell processes |
| Proteomics | The product of this CDS corresponds to spot CFP25 identified in short term culture filtrate by proteomics at the Statens Serum Institute, Denmark (see Weldingh et al., 1998). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted and cleavable signal sequence confirmed experimentally (See Malen et al., 2007). Detected by Western blot in M. tuberculosis H37Rv culture filtrate (See West et al., 2009). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 4h, 24h and 96h of starvation (see Betts et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2573015 | 2573707 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2301|cut2
VNDLLTRRLLTMGAAAAMLAAVLLLTPITVPAGYPGAVAPATAACPDAEVVFARGRFEPPGIGTVGNAFVSALRSKVNKNVGVYAVKYPADNQIDVGANDMSAHIQSMANSCPNTRLVPGGYSLGAAVTDVVLAVPTQMWGFTNPLPPGSDEHIAAVALFGNGSQWVGPITNFSPAYNDRTIELCHGDDPVCHPADPNTWEANWPQHLAGAYVSSGMVNQAADFVAGKLQ
Bibliography
- Weldingh K, Rosenkrands I, Jacobsen S, Rasmussen PB, Elhay MJ and Andersen P [1998]. Two-dimensional electrophoresis for analysis of Mycobacterium tuberculosis culture filtrate and purification and characterization of six novel proteins. Proteomics
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- West NP, Chow FM, Randall EJ, Wu J, Chen J, Ribeiro JM and Britton WJ [2009]. Cutinase-like proteins of Mycobacterium tuberculosis: characterization of their variable enzymatic functions and active site identification. Function Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant