Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionHydrolysis of cutin (a polyester that forms the structure of plant cuticle).
ProductProbable cutinase Cut2
CommentsRv2301, (MTCY339.08c), len: 230 aa. Probable cut2 (alternate gene name: cfp25), cutinase, highly similar to others from Mycobacteria tuberculosis e.g. MTCY13E12.04|Rv3451|O06318|CUT3_MYCTU (247 aa), FASTA scores: opt: 569, E(): 2.3e-27, (45.3% identity in 223 aa overlap); MT2037|MTCY39.35|RV1984C|Q10837|CUT1_MYCTU (217 aa), FASTA scores: opt: 383, E(): 3.4e-16 (42.9% identity in 217 aa overlap); O69691|Rv3724|MTV025.072 putative cutinase precursor (187 aa), FASTA scores: opt: 248, E(): 4.3e-08, (41.85% identity in 172 aa overlap); etc. Also similar to few others from other organisms e.g. Q9KK87 serine esterase cutinase from Mycobacterium avium (220 aa), FASTA scores: opt: 391, E(): 1.1e-16, (39.15% identity in 235 aa overlap); etc. Contains PS00095 C-5 cytosine-specific DNA methylases C-terminal signature. Belongs to the cutinase family. Start changed since first submission (+11 aa).
Functional categoryCell wall and cell processes
ProteomicsThe product of this CDS corresponds to spot CFP25 identified in short term culture filtrate by proteomics at the Statens Serum Institute, Denmark (see Weldingh et al., 1998). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted and cleavable signal sequence confirmed experimentally (See Malen et al., 2007). Detected by Western blot in M. tuberculosis H37Rv culture filtrate (See West et al., 2009). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 4h, 24h and 96h of starvation (see Betts et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS25730152573707+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2301|cut2
VNDLLTRRLLTMGAAAAMLAAVLLLTPITVPAGYPGAVAPATAACPDAEVVFARGRFEPPGIGTVGNAFVSALRSKVNKNVGVYAVKYPADNQIDVGANDMSAHIQSMANSCPNTRLVPGGYSLGAAVTDVVLAVPTQMWGFTNPLPPGSDEHIAAVALFGNGSQWVGPITNFSPAYNDRTIELCHGDDPVCHPADPNTWEANWPQHLAGAYVSSGMVNQAADFVAGKLQ
      
Bibliography