Gene Rv2321c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in arginine metabolism [catalytic activity: L-ornithine + a 2-oxo acid = L-glutamate 5-semialdehyde + an L-amino acid]. |
| Product | Probable ornithine aminotransferase (C-terminus part) RocD2 (ornithine--oxo-acid aminotransferase) |
| Comments | Rv2321c, (MTCY3G12.13), len: 181 aa. Probable rocD2, ornithine aminotransferase, highly similar to C-terminal region of other ornithine aminotransferases, e.g. Q9FC90|ROCD from Streptomyces coelicolor (407 aa), FASTA scores: opt: 628, E(): 1.2e-32, (55.35% identity in 168 aa overlap); P3802|OAT_BACSU|ROCD from Bacillus subtilis (401 aa), FASTA scores: opt: 477, E(): 4.3e-23, (42.1% identity in 178 aa overlap); BAB42057|ROCD|SA0818 from Staphylococcus aureus subsp. aureus N315 (396 aa), FASTA scores: opt: 437, E(): 1.5e-20, (41.3% identity in 170 aa overlap); etc. Contains PS00600 Aminotransferases class-III pyridoxal-phosphate attachment site. Belongs to class-III of pyridoxal-phosphate-dependent aminotransferases. Rv2322c|MTCY3G12.12 (upstream ORF) and Rv2321c|MTCY3G12.13 appear to be an ornithine aminotransferase homologue but are frameshifted - we can find no sequence error in the cosmid to account for this. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2594154 | 2594699 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2321c|rocD2
MIADEIQSGLACTGYPFACDHGGVLPDIYLLGKTLGGGAVPLSAMVADREIFGVVHPGEHGSTFGGNPLAAAIGTPVVSMVVWGECQARSAKLGAHLHQRLADLIGDGAVALRGLGWWADVDIERALAIGTDMSMRLADRGVLLKDTYGAALRFAPPLVITAQEIDCAVRRFADALWEAGS
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
