Gene Rv2322c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in arginine metabolism [catalytic activity: L-ornithine + a 2-oxo acid = L-glutamate 5-semialdehyde + an L-amino acid]. |
| Product | Probable ornithine aminotransferase (N-terminus part) RocD1 (ornithine--oxo-acid aminotransferase) |
| Comments | Rv2322c, (MTCY3G12.12), len: 221 aa. Probable rocD1, ornithine aminotransferase, highly similar to N-terminal region of other ornithine aminotransferases, e.g. Q9FC90|ROCD from Streptomyces coelicolor (407 aa), FASTA scores: opt: 770, E(): 8.7e-40, (55.7% identity in 201 aa overlap); BAB42057|ROCD|SA0818 from Staphylococcus aureus subsp. aureus N315 (396 aa) FASTA scores: opt: 632, E(): 2.2e-31, (46.1% identity in 208 aa overlap); P38021|OAT_BACSU|ROCD from Bacillus subtilis (401 aa), FASTA scores: opt: 626, E(): 5.1e-31, (43.1% identity in 218 aa overlap); etc. Belongs to class-III of pyridoxal-phosphate-dependent aminotransferases. Rv2322c|MTCY3G12.12 and Rv2321c|MTCY3G12.13 (upstream ORF) appear to be an ornithine aminotransferase homologue but are frameshifted - we can find no sequence error in the cosmid to account for this. |
| Functional category | Intermediary metabolism and respiration |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2594699 | 2595364 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2322c|rocD1
MTNLADATQATMALVERHAAHNYSPLPVVAASAEGAWIADIDGLRYLDWLAAYSAVNLGHRNPASTATAHAQVDTVTLLNRALHADRLGPLGAALAQLCGKDVVLPMNSDAEAVESGLRVARKWGADVNGLPAGRHDIILANNNFHGHTSSVVSFSSDPAAGSGVEPSTPGLRSVPFGDAAAPAQTIDDNTVADLLEPIPGQAGIIVPADDYLPAASSTTC
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Golby P, Nunez J, Cockle PJ, Ewer K, Logan K, Hogarth P, Vordermeier HM, Hinds J, Hewinson RG and Gordon SV [2008]. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Regulon
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
