Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductHypothetical protein
CommentsRv2331, (MT2393, MTCY3G12.03c), len: 128 aa. Hypothetical unknown protein; shortened version of MTCY3G12.03c to eliminate overlap with MTCY3G12.04.
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010).
TranscriptomicsDNA microarrays show higher level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS26042972604683+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2331|Rv2331
VPPVFLPQIGRLTPDAVGEAIGIAADDIPMAARWIGSRPCSLIGQPNTMGDEMGYLGPGLAGQRCVDRLVMGASRSTCSRLPVIASVDERLSVLKPVRPRLHSISFIFKGRPGEVYLTVTGYNFRGVP