Gene Rv2387
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv2387, (MTCY253.34c), len: 417 aa. Conserved protein, showing some similarities with others e.g. Q9K663|BH3869 hypothetical protein from Bacillus halodurans (337 aa), FASTA scores: opt: 343, E(): 4.8e-14, (29.0% identity in 400 aa overlap); AAK25471|CC3509 hypothetical protein from Caulobacter crescentus (365 aa), FASTA scores: opt: 282, E(): 3.2e-10, (32.6% identity in 399 aa overlap); P73953|SLR1512 [D90911_21] conserved hypothetical protein from Synechocystis sp. strain PCC6803 (374 aa), FASTA scores: opt: 230, E(): 5.5e-07; (24.75% identity in 408 aa overlap); etc. Contains PS00213 Lipocalin signature. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2680765 | 2682018 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2387|Rv2387
MLHEFWVNFTHNLFKPLLLFFYFGFLIPIFKVRFEFPYVLYQGLTLYLLLAIGWHGGEELAKIKPSNVGAIVGFMVVGFALNFVIGTLAYFLLSKLTAMRRVDRATVAGYYGSDSAGTFATCVAVLTSVGMAFDAYMPVMLAVMEIPGCLVALYLVARLRHRGMNEAGYMADEPGYTTAAMIGAGPGTPARPAHSDSLTAQAERGIEEELELSLEKREHPNWDEDGVKDSGTNASIFSRELLQEVFLNPGLVLLFGGIVIGLISGLQGQKVLHDDDNFFVAAFQGVLCLFLLEMGMTASRKLKDLASAGSGFVFFGLLAPNLFATLGIIVAHGYAYVTNNDFAPGTYVLFAVLCGAASYIAVPAVQRLAIPEASPTLPLAASLGLTFSYNVTIGIPLYIEIARIVGQWFPATGASIG
Bibliography
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Rodrigue S et al. [2007]. Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. Regulon
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
