Gene Rv2390c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2390c, (MTCY253.31), len: 185 aa. Conserved hypothetical protein, similar to other Mycobacterium tuberculosis proteins Q11032|YD62_MYCTU|MTCY02B10.26c|Rv1362c hypothetical 23.5 kDa protein (220 aa), FASTA scores: opt: 223, E(): 2.1e-07, (27.4% identity in 190 aa overlap); and Q11033|YD63_MYCTU|MTCY02B10.27c|Rv1363c hypothetical 28.3 kDa protein (261 aa), FASTA scores: opt: 238, E(): 2.7e-08, (27.6% identity in 163 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2683709 | 2684266 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2390c|Rv2390c
MAIFGRGHGASEPGGTGEPAETPGRGRLTRSVIGWVGAVAVVVSLAGSGWCGWVLFEKHQTDVAAGQALQAARSYVVKLATMDCERIDHNMRDILEGSTGEFKDKYGKSSAHLRQLLADNRVATHGTVVAASVKSATTNKVVVLMFIDQSVSNRNSPTPQIDRSRIKVIMDKVNGRWLASKVELL
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Golby P, Nunez J, Cockle PJ, Ewer K, Logan K, Hogarth P, Vordermeier HM, Hinds J, Hewinson RG and Gordon SV [2008]. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
