Gene Rv2453c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Involved in molybdenum cofactor biosynthesis. LINKS a guanosine 5'-phosphate to molydopterin (MPT) forming molybdopterin guanine dinucleotide (MGD). |
Product | Probable molybdopterin-guanine dinucleotide biosynthesis protein A MobA |
Comments | Rv2453c, (MT2528, MTV008.09c), len: 201 aa. Probable mobA, molybdopterin-guanine dinucleotide biosynthesis protein A, similar to others e.g. Q9F8G7 from Carboxydothermus hydrogenoformans (224 aa), FASTA scores: opt: 249, E(): 3.9e-08, (30.6% identity in 173 aa overlap); P95645|MOBA_RHOSH|mob|Y09560 from Rhodobacter sphaeroides (199 aa), FASTA scores: opt: 240, E(): 1.2e-07, (33.9% identity in 186 aa overlap); Q9X7K0|MOBA_RHOCA from Rhodobacter capsulatus (Rhodopseudomonas capsulata) (191 aa), FASTA scores: opt: 217, E(): 2.9e-06, (37.4% identity in 123 aa overlap); etc. Belongs to the MobA family. |
Functional category | Intermediary metabolism and respiration |
Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2753018 | 2753623 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2453c|mobA VAELAPDTVPLAGVVLAGGESRRMGRDKATLPLPGGTTTLVEHMVGILGQRCAPVFVMAAPGQPLPTLPVPVLRDELPGLGPLPATGRGLRAAAEAGVRLAFVCAVDMPYLTVELIEDLARRAVQTDAEVVLPWDGRNHYLAAVYRTDLADRVDTLVGAGERKMSALVDASDALRIVMADSRPLTNVNSAAGLHAPMQPGR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant