Gene Rv2456c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in transport of undetermined substrate (possibly sugar) across the membrane. Responsible for the translocation of the substrate across the membrane. |
| Product | Probable conserved integral membrane transport protein |
| Comments | Rv2456c, (MTV008.12c), len: 418 aa. Probable conserved integral membrane transport protein, involved in a efflux system, weakly similar to many e.g. Q9RUR0|YD22_DEIRA|DR1322 putative sugar efflux transporter from Deinococcus radiodurans (389 aa), FASTA scores: opt: 224, E(): 8.4e-06, (24.45% identity in 409 aa overlap); Q9UYY0|PAB0913 multidrug resistance protein from Pyrococcus abyssi (410 aa), FASTA scores: opt: 210, E(): 5.6e-05, (21.8% identity in 408 aa overlap); etc. Contains PS00216 Sugar transport proteins signature 1. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2756936 | 2758192 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2456c|Rv2456c
MSGTVVAVPPRVARALDLLNFSLADVRDGLGPYLSIYLLLIHDWDQASIGFVMAVGGIAAIVAQTPIGALVDRTTAKRALVVAGAVLVTAAAVAMPLFAGLYSISVLQAVTGIASSVFAPALAAITLGAVGPQFFARRIGRNEAFNHAGNASAAGATGALAYFFGPVVVFWVLAGMALISVLATLRIPPDAVDHDLARGMDHAPGEPHPQPSRFTVLAHNRELVIFGAAVVAFHFANAAMLPLVGELLALHNRDEGTALMSSCIVAAQVVMVPVAYVVGTRADAWGRKPIFLVGFAVLTARGFLYTLSDNSYWLVGVQLLDGIGAGIFGALFPLVVQDVTHGTGHFNISLGAVTTATGIGAALSNLVAGWIVVVAGYDAAFMSLGALAGAGFLLYLVAMPETVDSDVRVRSRPTLGGK
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
