Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv2474c, (MTV008.30c), len: 217 aa. Hypothetical protein. Shows weak similarity with Q9L246|SC6D10.18c hypothetical 24.9 KDA protein from Streptomyces coelicolor (238 aa), FASTA scores: opt: 111, E(): 5.6, (30% identity in 233 aa overlap), blastp scores: Score= 135, E= 3.5e-07, P= 3.5e-07, Identities= 55/182 (30%).
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS27763162776969-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2474c|Rv2474c
VVERGLWLPDPAHRADLATFVDHALRLDDAAVIRIRARSTGLLSAWVATGFDVLASRVVAGKVRPDDLSVAARSLAHGLATTDASGYVDPGYSMDSAWRGGLPPESGFTYLDDVPARVMLDLAHRGARLAKEHGSSAGPPVSLLDQEVIQVSSADVVVGLPMRCVFALTAMGFLPQSAETISADELIRVRISPAWLRLDARFGSVYRHRGHAALVLR