Gene Rv2484c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | May be involved in synthesis of triacylglycerol |
| Product | Possible triacylglycerol synthase (diacylglycerol acyltransferase) |
| Comments | Rv2484c, (MTV008.40c), len: 491 aa. Possible triacylglycerol synthase (See Daniel et al., 2004), highly similar or similar to many Mycobacterial hypothetical proteins e.g. Q9X7A8|MLCB1610.05|ML1244 conserved membrane protein from Mycobacterium leprae (491 aa), FASTA scores: opt: 2459, E(): 3e-138, (75.15% identity in 483 aa overlap); O53304|YU87_MYCTU|Rv3087|MTV013.08 from Mycobacterium tuberculosis (472 aa), FASTA scores: opt: 527, E(): 8.1e-24, (29.1% identity in 485 aa overlap); O53305|YU88_MYCTU|Rv3088|MT3173|MTV013.09 from Mycobacterium tuberculosis (474 aa), FASTA scores: opt: 370, E(): 1.6e-14, (26.05% identity in 422 aa overlap); etc. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2791019 | 2792494 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2484c|Rv2484c
MAESGESPRLSDELGPVDYLMHRGEANPRTRSGIMALELLDGTPDWDRFRTRFENASRRVLRLRQKVVVPTLPTAAPRWVVDPDFNLDFHVRRVRVSGPATLREVLDLAEVILQSPLDISRPLWTATLVEGMADGRAAMLLHVSHAVTDGVGGVEMFAQIYDLERDPPPRSTPPQPIPEDLSPNDLMRRGINHLPIAVVGGVLDALSGAVSMAGRAVLEPVSTVSGILGYARSGIRVLNRAAEPSPLLRRRSLTTRTEAIDIRLADLHKAAKAGGGSINDAYLAGLCGALRRYHEALGVPISTLPMAVPVNLRAEGDAAGGNQFTGVNLAAPVGTIDPVARMKKIRAQMTQRRDEPAMNIIGSIAPVLSVLPTAVLEGITGSVIGSDVQASNVPVYPGDTYLAGAKILRQYGIGPLPGVAMMVVLISRGGWCTVTVRYDRASVRNDELFAQCLQAGFDEILALAGGPAPRVLPASFDTQGAGSVPRSVSGS
Bibliography
- Daniel J, Deb C, Dubey VS, Sirakova TD, Abomoelak B, Morbidoni HR and Kolattukudy PE [2004]. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. Function Product
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
