Gene Rv2491
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2491, (MTV008.47), len: 207 aa. Conserved hypothetical protein, similar in part to other hypothetical proteins e.g. O29139|AF1126 from Archaeoglobus fulgidus (151 aa), FASTA scores: opt: 293, E(): 2.8e-11, (42.85% identity in 126 aa overlap); O66531|AQ_134 from Aquifex aeolicus (151 aa), FASTA scores: opt: 261, E(): 2.6e-09, (37.75% identity in 106 aa overlap); Q9HKU3|TA0501 from Thermoplasma acidophilum (161 aa), FASTA scores: opt: 260, E(): 3.2e-09, (35.9% identity in 117 aa overlap); etc. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2806665 | 2807288 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2491|Rv2491
MVDTSAPASRLDTDPRRAHVSLSKHPYQIGVFGSGTIGPRVYELAYQVGAEIAKQGHILISGGMTGTMEASSRGASDADGLVVGVLPGDKFTDGNAYSTIKILSGMQFARNYITGLSCHGAIVVGGSSGAYEEARRVWEGRGPVVVLANSGSPTGASAQMLSMQEIFGVAFPEDKPKPWRVFSAATPAESVSLVIGLIRKGYAQHEP
Bibliography
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant