Gene Rv2499c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Possible oxidase regulatory-related protein |
| Comments | Rv2499c, (MTCY07A7.05c), len: 185 aa. Possible oxidase regulatory-related protein, similar to many maoC monoamine oxidase regulatory protein e.g. Q9RUZ1|DR1239 MAOC-related protein from Deinococcus radiodurans (160 aa), FASTA scores: opt: 519, E(): 7.6e-28, (58.1% identity in 148 aa overlap); BAB48392|MLR0905 Probable monoamine oxidase regulatory protein from Rhizobium loti (Mesorhizobium loti) (150 aa), FASTA scores: opt: 480, E(): 2.9e-25, (49.0% identity in 149 aa overlap); Q9HN18|MAOC1|VNG2290G monoamine oxidase regulatory-like from Halobacterium sp. strain NRC-1 (208 aa), FASTA scores: opt: 419, E(): 4.6e-21, (45.6% identity in 158 aa overlap); P77455|MAOC_ECOLI|PAAZ|B1387 MaoC protein (Phenylacetic acid degradation protein paaZ) from Escherichia coli strain K12 (681 aa), FASTA scores: opt: 252, E(): 1.9e-09, (36.0% identity in 172 aa overlap); etc. But also similar to other proteins with different putative functions e.g. Q9HRM9|MAOC2|VNG0626G molybdenum cofactor biosynthesis protein from Halobacterium sp strain NRC-1 (157 aa), FASTA scores: opt: 380, E(): 1.5e-18, (45.75% identity in 153 aa overlap); Q9KIF1 FKBR2 from Streptomyces hygroscopicus var. ascomyceticus (175 aa), FASTA scores: opt: 355, E(): 7.6e-17, (42.0% identity in 150 aa overlap); CAC36828|Q99Q03|SAPE Spore associated protein from Streptomyces coelicolor (174 aa), FASTA scores: opt: 318, E(): 2.2e-14, (41.45% identity in 152 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2813173 | 2813730 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2499c|Rv2499c
VTKHAGDRESDDAVSACRVAGSTVGRRILQRGLWFEEFQIGTTYLHRPGRTVTEADNVLFTTLTMNTQSLHLDAAWAGQQPGFRGERLVNSMFTLSTMVGLSVAQLTLGTIVANLGFSEVSFPKPVFHGDTLYAETVCTGKRESKSRPGEGIVTLEHIARNQHGEVVARAVRTTLVQKQSIKEAQ
Bibliography
- Sugino H et al. [1992]. A monoamine-regulated Klebsiella aerogenes operon containing the monoamine oxidase structural gene (maoA) and the maoC gene. Homolog Sequence
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant