Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPE family protein PE26
CommentsRv2519, (MTV009.04), len: 492 aa. PE26, Member of the M. tuberculosis PE family (see citation below), highly similar to many e.g. Q50630|YP91_MYCTU|Rv2591|MT2668.1|MTCY227.10c (543 aa), FASTA scores: opt: 848, E(): 3e-30, (39.55% identity in 445 aa overlap).
Functional categoryPe/ppe
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28357852837263+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv2519|2835785-2837263|+|PE26|downstream:0|upstream:0
gtgtcgcgtctgatcgtggctccggactggctggcgtcagcagcggcggaggtgcaaagcatcggctcggcgctgagcgcggcgaacgccgcggccgcggcccccaccaccctattggtggccgccgccgaagacgaggtatccgcagcggccgcagcgctattcgccaactacggccgggagtatcagacgctgagtgtgcggttcgcctcgcttgatcagcagttcgcgcaagcactgaactcggcggcagcgtcgtatcagacggccgaagccacgggtgcgtcgctcgtgcagaccgcgacacaaggtgtactgggtgtgatcaatgcgcccaccgagttcatgttcggacgctcgctgatcggcgacggagctgacggcacggctgccagccccatcggcgagcccggcggaatcctgtacggcgacggcggaaacggctactcccagaccacgcccggagctgtcggcggagccggcgggtcggccggatttatcggtaacggtggcgccgggggcgccggcgggcccggcgccggcggcgggactggaggcctcggcggctggttatggggcaacaacggcgccgctggcaccggcgacccagttaacgttgccgtccccctgcgcgtggaaaacaactttccgctggtgaacctcttggtcaaccgcgggccaactgtccccatactgctggacacgggatcctcgagtctcgtcatcccattctggaaaatcgggtggcagaacctgggcttgcccaccgggttcgatgtcgttcactacggcaatggcgtgagcatcgtctacgccgacgtgcccacgacggtcgatttcggtggcggcgccgctaccacaccgacctccgtccatgtcggtatcctgccgtacccgcgaaaccttgacagcctggtcctcatcgcttccggcggcgctttcggacccaacggaaacggcatactgggcatcgggccgaatgtggggtcgtatgccgtcagcgggcccggcaacgttgtcacgaccgatttgccgggccaactcaacgaaggcaccctcatcgacattcccggcggctacatgcagttcggccccaacacgggcactccaatcacctccgtgaccggggcaccgatcaccgtgctgaacgttcagatcggcggctacgaccccaacgggggctactggtcactcccctcgattttcgattcgggcggcaaccacggaacgcttccggcggtgattctcggcacgggccagacaaccggttacgccccgccgggcacggttatctcaatctcaatacatgacaaccagacgctgctgtatcagtacacgacaaccgcgagcaacagcccagtggtcacggcagacccccgactcaacaccggtctaaccccgttcctgctgggaccggtatatatctcgaacaaccctagcggtgtcgggacggtggtgttcaattacccgccaccgtag
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2519|PE26
VSRLIVAPDWLASAAAEVQSIGSALSAANAAAAAPTTLLVAAAEDEVSAAAAALFANYGREYQTLSVRFASLDQQFAQALNSAAASYQTAEATGASLVQTATQGVLGVINAPTEFMFGRSLIGDGADGTAASPIGEPGGILYGDGGNGYSQTTPGAVGGAGGSAGFIGNGGAGGAGGPGAGGGTGGLGGWLWGNNGAAGTGDPVNVAVPLRVENNFPLVNLLVNRGPTVPILLDTGSSSLVIPFWKIGWQNLGLPTGFDVVHYGNGVSIVYADVPTTVDFGGGAATTPTSVHVGILPYPRNLDSLVLIASGGAFGPNGNGILGIGPNVGSYAVSGPGNVVTTDLPGQLNEGTLIDIPGGYMQFGPNTGTPITSVTGAPITVLNVQIGGYDPNGGYWSLPSIFDSGGNHGTLPAVILGTGQTTGYAPPGTVISISIHDNQTLLYQYTTTASNSPVVTADPRLNTGLTPFLLGPVYISNNPSGVGTVVFNYPPP