Gene Rv2519
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PE family protein PE26 |
| Comments | Rv2519, (MTV009.04), len: 492 aa. PE26, Member of the M. tuberculosis PE family (see citation below), highly similar to many e.g. Q50630|YP91_MYCTU|Rv2591|MT2668.1|MTCY227.10c (543 aa), FASTA scores: opt: 848, E(): 3e-30, (39.55% identity in 445 aa overlap). |
| Functional category | Pe/ppe |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2835785 | 2837263 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2519|PE26
VSRLIVAPDWLASAAAEVQSIGSALSAANAAAAAPTTLLVAAAEDEVSAAAAALFANYGREYQTLSVRFASLDQQFAQALNSAAASYQTAEATGASLVQTATQGVLGVINAPTEFMFGRSLIGDGADGTAASPIGEPGGILYGDGGNGYSQTTPGAVGGAGGSAGFIGNGGAGGAGGPGAGGGTGGLGGWLWGNNGAAGTGDPVNVAVPLRVENNFPLVNLLVNRGPTVPILLDTGSSSLVIPFWKIGWQNLGLPTGFDVVHYGNGVSIVYADVPTTVDFGGGAATTPTSVHVGILPYPRNLDSLVLIASGGAFGPNGNGILGIGPNVGSYAVSGPGNVVTTDLPGQLNEGTLIDIPGGYMQFGPNTGTPITSVTGAPITVLNVQIGGYDPNGGYWSLPSIFDSGGNHGTLPAVILGTGQTTGYAPPGTVISISIHDNQTLLYQYTTTASNSPVVTADPRLNTGLTPFLLGPVYISNNPSGVGTVVFNYPPP
Bibliography
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Fontán PA et al. [2008]. Mycobacterium tuberculosis sigma factor E regulon modulates the host inflammatory response. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
