Gene Rv2551c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2551c, (MTCY159.05), len: 139 aa. Conserved hypothetical protein, similar to the second part of Q9XAP1|SC10A7.34c putative type IV peptidase from Streptomyces coelicolor (259 aa), FASTA scores: opt: 243, E(): 7.4e-08, (40.95% identity in 144 aa overlap). Also some similarity with other proteins e.g. AAK58497|GSPO GSPO protein from Acetobacter diazotrophicus (261 aa), FASTA scores: opt: 152, E(): 0.025, (33.35% identity in 135 aa overlap). |
| Functional category | Conserved hypotheticals |
| Transcriptomics | mRNA identified by microarray analysis; transcription repressed at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see Fisher et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2870775 | 2871194 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2551c|Rv2551c
MLAAAVLAWMGVLCVCDVRQRRLPNWLTLPGAGVILLFAGLAGRGVPALAGAAALAGVYLLVHLALPAAMGAGDVKLAIGLGGLTGCFGVEVWFLAALAAPLLTAVCGVMVTPWGVRTLPHGPSMCVASLGAVGLALLG
Bibliography
- Fisher MA, Plikaytis BB and Shinnick TM [2002]. Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. Transcriptome Regulation
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
