Gene Rv2556c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2556c, (MTCY09C4.12), len: 129 aa. Conserved hypothetical protein, highly similar to others e.g. Q9EWY5|2SCG38.34 conserved hypothetical protein from Streptomyces coelicolor (140 aa), FASTA scores: opt: 488, E(): 8.2e-26, (58.8% identity in 131 aa overlap); Q9L9G4|NOVD NOVD protein from Streptomyces sphaeroides (143 aa), FASTA scores: opt: 474, E(): 7.2e-25, (60.85% identity in 120 aa overlap); Q9X2I5|TM1872 from Thermotoga maritima (132 aa), FASTA scores: opt: 270, E(): 2.7e-11, (39.55% identity in 129 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2876576 | 2876965 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2556c|Rv2556c
VLDVDTARRRIVDLTDAVRAFCTAHDDGLCNVFVPHATAGVAIIETGAGSDEDLVDTLVRLLPRDDRYRHAHGSYGHGADHLLPAFVAPSVTVPVSGGQPLLGTWQSIVLVDLNQDNPRRSVRLSFVEG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
