Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThought to be involved in active transport of glutamine across the membrane (import). Responsible for the translocation of the substrate across the membrane.
ProductProbable glutamine-transport ATP-binding protein ABC transporter GlnQ
CommentsRv2564, (MTCY9C4.04c), len: 330 aa. Probable glnQ, glutamine-transport ATP-binding protein ABC transporter (see citation below), highly similar to many e.g. Q9L0J9|SCD40A.12c putative ABC-transporter ATP-binding protein from Streptomyces coelicolor (246 aa), FASTA scores: opt: 598, E(): 2.5e-26, (46.35% identity in 218 aa overlap); O54136|SC2E9.11 from Streptomyces coelicolor (230 aa), FASTA scores: opt: 592, E(): 5.1e-26, (46.55% identity in 219 aa overlap); O29244|AF1018 from Archaeoglobus fulgidus (228 aa), FASTA scores: opt: 580, E(): 2.4e-25, (42.4% identity in 210 aa overlap); P75831|YBJZ_ECOLI|B0879 from Escherichia coli strain K12 (648 aa), FASTA scores: opt: 555, E(): 1.3e-23, (39.65% identity in 232 aa overlap); etc. Also highly similar to O53618|Rv0073|MTV030.17 ABC-transporter ATP-binding subunit from Mycobacterium tuberculosis (330 aa), FASTA scores: opt: 1782, E(): 4.7e-92, (83.65% identity in 330 aa overlap); etc. Shows some similarity to Q11040|YC81_MYCTU|MTCY50.01|Rv1281c|MT1318 hypothetical ABC transporter ATP-binding protein from Mycobacterium tuberculosis (612 aa) (32.9 % identity in 234 aa overlap). Contains PS00017 ATP/GTP-binding site motif A (P-loop), PS00211 ABC transporters family signature, and PS00889 Cyclic nucleotide-binding domain signature 2. Belongs to the ATP-binding transport protein family (ABC transporters).
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28833422884334+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2564|glnQ
MGGLTISDLVVEYSSGGYAVRPIDGLSLDVAPGSLVILLGPSGCGKTTLLSCLGGILRPKSGSIKFDDVDITTLEGAALAKYRRDKVGIVFQAFNLVSSLTALENVMVPLRAAGVSRAAARKRAEDLLIRVNLGERMKHRPGDMSGGQQQRVAVARAIALDPQLILADEPTAHLDFIQVEEVLRLIRSLAQGDRVVVVATHDSRMLPLADRVLELMPAQVSPNQPPETVHVKAGEVLFEQSTMGDLIYVVSEGEFEIVRELADGGEELVKTAAPGDYFGEIGVLFHLPRSATVRARSDATAVGYTAQAFRERLGVTRVADLIEHRELASE