Gene Rv2564
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in active transport of glutamine across the membrane (import). Responsible for the translocation of the substrate across the membrane. |
| Product | Probable glutamine-transport ATP-binding protein ABC transporter GlnQ |
| Comments | Rv2564, (MTCY9C4.04c), len: 330 aa. Probable glnQ, glutamine-transport ATP-binding protein ABC transporter (see citation below), highly similar to many e.g. Q9L0J9|SCD40A.12c putative ABC-transporter ATP-binding protein from Streptomyces coelicolor (246 aa), FASTA scores: opt: 598, E(): 2.5e-26, (46.35% identity in 218 aa overlap); O54136|SC2E9.11 from Streptomyces coelicolor (230 aa), FASTA scores: opt: 592, E(): 5.1e-26, (46.55% identity in 219 aa overlap); O29244|AF1018 from Archaeoglobus fulgidus (228 aa), FASTA scores: opt: 580, E(): 2.4e-25, (42.4% identity in 210 aa overlap); P75831|YBJZ_ECOLI|B0879 from Escherichia coli strain K12 (648 aa), FASTA scores: opt: 555, E(): 1.3e-23, (39.65% identity in 232 aa overlap); etc. Also highly similar to O53618|Rv0073|MTV030.17 ABC-transporter ATP-binding subunit from Mycobacterium tuberculosis (330 aa), FASTA scores: opt: 1782, E(): 4.7e-92, (83.65% identity in 330 aa overlap); etc. Shows some similarity to Q11040|YC81_MYCTU|MTCY50.01|Rv1281c|MT1318 hypothetical ABC transporter ATP-binding protein from Mycobacterium tuberculosis (612 aa) (32.9 % identity in 234 aa overlap). Contains PS00017 ATP/GTP-binding site motif A (P-loop), PS00211 ABC transporters family signature, and PS00889 Cyclic nucleotide-binding domain signature 2. Belongs to the ATP-binding transport protein family (ABC transporters). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2883342 | 2884334 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2564|glnQ
MGGLTISDLVVEYSSGGYAVRPIDGLSLDVAPGSLVILLGPSGCGKTTLLSCLGGILRPKSGSIKFDDVDITTLEGAALAKYRRDKVGIVFQAFNLVSSLTALENVMVPLRAAGVSRAAARKRAEDLLIRVNLGERMKHRPGDMSGGQQQRVAVARAIALDPQLILADEPTAHLDFIQVEEVLRLIRSLAQGDRVVVVATHDSRMLPLADRVLELMPAQVSPNQPPETVHVKAGEVLFEQSTMGDLIYVVSEGEFEIVRELADGGEELVKTAAPGDYFGEIGVLFHLPRSATVRARSDATAVGYTAQAFRERLGVTRVADLIEHRELASE
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant