Gene Rv2570
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2570, (MTCY227.31c), len: 129 aa. Conserved hypothetical protein, similar to Q98GQ7|MLR3218 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (133 aa), FASTA scores: opt: 174, E(): 9.6e-05, (32.25% identity in 124 aa overlap); Q9A390|CC3314 hypothetical protein from Caulobacter crescentus (129 aa), FASTA scores: opt: 155, E(): 0.0017, (33.35% identity in 108 aa overlap); and Q9A2Y0|CC3426 hypothetical protein from Caulobacter crescentus (120 aa), FASTA scores: opt: 144, E(): 0.0083, (32.95% identity in 91 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2894512 | 2894901 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2570|Rv2570
VATWDDVARIVGGLPLTAEQAPHDWRVGRKLLAWERPLRKSDREALTRAGSEPPSGDIVGVRVSDEGVKFALIADEPGVYFTTPHFDGYPAVLVRLAEIEVRDLEELITEAWLMQAPKQLVQAFLANSG
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
