Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible conserved membrane glycine rich protein
CommentsRv2575, (MTCY227.26c), len: 293 aa. Possible conserved membrane gly-rich protein, highly similar to hypothetical proteins e.g. Q9RR98|DR2596 conserved hypothetical protein from Deinococcus radiodurans (313 aa), FASTA scores: opt: 734, E(): 2.8e-38, (42.95% identity in 291 aa overlap); Q9HV81|PA4717 from Pseudomonas aeruginosa (297 aa), FASTA scores: opt: 641, E(): 1.5e-32, (43.35% identity in 300 aa overlap); Q98IA4|MLL2493 from Rhizobium loti (Mesorhizobium loti) (306 aa), FASTA scores: opt: 628, E(): 1e-31, (38.45% identity in 307 aa overlap); etc. Contains PS00142 Neutral zinc metallopeptidases, zinc-binding region signature.
Functional categoryCell wall and cell processes
ProteomicsIdentified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28993392900220+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2575|Rv2575
MTFNEGVQIDTSTTSTSGSGGGRRLAIGGGLGGLLVVVVAMLLGVDPGGVLSQQPLDTRDHVAPGFDLSQCRTGADANRFVQCRVVATGNSVDAVWKPLLPGYTRPHMRLFSGQVGTGCGPASSEVGPFYCPVDKTAYFDTDFFQVLVTQFGSSGGPFAEEYVVAHEYGHHVQNLLGVLGRAQQGAQGAAGSGVRTELQADCYAGVWAYYASTVKQESTGVPYLEPLSDKDIQDALAAAAAVGDDRIQQQTTGRTNPETWTHGSAAQRQKWFTVGYQTGDPNICDTFSAADLG