Gene Rv2575
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved membrane glycine rich protein |
| Comments | Rv2575, (MTCY227.26c), len: 293 aa. Possible conserved membrane gly-rich protein, highly similar to hypothetical proteins e.g. Q9RR98|DR2596 conserved hypothetical protein from Deinococcus radiodurans (313 aa), FASTA scores: opt: 734, E(): 2.8e-38, (42.95% identity in 291 aa overlap); Q9HV81|PA4717 from Pseudomonas aeruginosa (297 aa), FASTA scores: opt: 641, E(): 1.5e-32, (43.35% identity in 300 aa overlap); Q98IA4|MLL2493 from Rhizobium loti (Mesorhizobium loti) (306 aa), FASTA scores: opt: 628, E(): 1e-31, (38.45% identity in 307 aa overlap); etc. Contains PS00142 Neutral zinc metallopeptidases, zinc-binding region signature. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2899339 | 2900220 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2575|Rv2575
MTFNEGVQIDTSTTSTSGSGGGRRLAIGGGLGGLLVVVVAMLLGVDPGGVLSQQPLDTRDHVAPGFDLSQCRTGADANRFVQCRVVATGNSVDAVWKPLLPGYTRPHMRLFSGQVGTGCGPASSEVGPFYCPVDKTAYFDTDFFQVLVTQFGSSGGPFAEEYVVAHEYGHHVQNLLGVLGRAQQGAQGAAGSGVRTELQADCYAGVWAYYASTVKQESTGVPYLEPLSDKDIQDALAAAAAVGDDRIQQQTTGRTNPETWTHGSAAQRQKWFTVGYQTGDPNICDTFSAADLG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant