Gene Rv2584c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in purine salvage. Catalyses a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis [catalytic activity: AMP + pyrophosphate = adenine + 5-phospho-alpha-D-ribose 1-diphosphate]. |
| Product | Adenine phosphoribosyltransferase Apt (APRT) (AMP diphosphorylase) (AMP pyrophosphorylase) (transphosphoribosidase) |
| Comments | Rv2584c, (MTCY227.17), len: 223 aa. Probable apt, adenine phosphoribosyltransferase, similar, but longer in N-terminus, to others e.g. O87330|APT_CORGL from Corynebacterium glutamicum (Brevibacterium flavum) (185 aa), FASTA scores: opt: 524, E(): 1.3e-24, (50.95% identity in 159 aa overlap); P52561|APT_STRCO from Streptomyces coelicolor (182 aa), FASTA scores: opt: 503, E(): 2.3e-23, (51.85% identity in 164 aa overlap); P47956|APT_MUSPA|APRT from Mus pahari (Shrew mouse) (180 aa), FASTA scores: opt: 419, E(): 2.5e-18, (44.7% identity in 170 aa overlap); P07672|P09993|P77121|APT_ECOLI|B0469 from Escherichia coli strain K12 (183 aa), FASTA scores: opt: 393, E(): 1.9e-18, (42.6% identity in 162 aa overlap); etc. Contains PS00103 Purine/ pyrimidine phosphoribosyl transferases signature, and PS00144 Asparaginase / glutaminase active site signature 1. Belongs to the purine/pyrimidine phosphoribosyltransferase family. Nearest initiation codon indicated by homology is TTG at 17426 or GTG at 17465. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2910229 | 2910900 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2584c|apt
VCHGGTWAGDYVLNVIATGLSLKARGKRRRQRWVDDGRVLALGESRRSSAISVADVVASLTRDVADFPVPGVEFKDLTPLFADRRGLAAVTEALADRASGADLVAGVDARGFLVAAAVATRLEVGVLAVRKGGKLPRPVLSEEYYRAYGAATLEILAEGIEVAGRRVVIIDDVLATGGTIGATRRLLERGGANVAGAAVVVELAGLSGRAALAPLPVHSLSRL
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant