Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in purine salvage. Catalyses a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis [catalytic activity: AMP + pyrophosphate = adenine + 5-phospho-alpha-D-ribose 1-diphosphate].
ProductAdenine phosphoribosyltransferase Apt (APRT) (AMP diphosphorylase) (AMP pyrophosphorylase) (transphosphoribosidase)
CommentsRv2584c, (MTCY227.17), len: 223 aa. Probable apt, adenine phosphoribosyltransferase, similar, but longer in N-terminus, to others e.g. O87330|APT_CORGL from Corynebacterium glutamicum (Brevibacterium flavum) (185 aa), FASTA scores: opt: 524, E(): 1.3e-24, (50.95% identity in 159 aa overlap); P52561|APT_STRCO from Streptomyces coelicolor (182 aa), FASTA scores: opt: 503, E(): 2.3e-23, (51.85% identity in 164 aa overlap); P47956|APT_MUSPA|APRT from Mus pahari (Shrew mouse) (180 aa), FASTA scores: opt: 419, E(): 2.5e-18, (44.7% identity in 170 aa overlap); P07672|P09993|P77121|APT_ECOLI|B0469 from Escherichia coli strain K12 (183 aa), FASTA scores: opt: 393, E(): 1.9e-18, (42.6% identity in 162 aa overlap); etc. Contains PS00103 Purine/ pyrimidine phosphoribosyl transferases signature, and PS00144 Asparaginase / glutaminase active site signature 1. Belongs to the purine/pyrimidine phosphoribosyltransferase family. Nearest initiation codon indicated by homology is TTG at 17426 or GTG at 17465.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29102292910900-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2584c|apt
VCHGGTWAGDYVLNVIATGLSLKARGKRRRQRWVDDGRVLALGESRRSSAISVADVVASLTRDVADFPVPGVEFKDLTPLFADRRGLAAVTEALADRASGADLVAGVDARGFLVAAAVATRLEVGVLAVRKGGKLPRPVLSEEYYRAYGAATLEILAEGIEVAGRRVVIIDDVLATGGTIGATRRLLERGGANVAGAAVVVELAGLSGRAALAPLPVHSLSRL