Gene Rv2631
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2631, (MTCY441.01, MTCY01A10.01c), len: 432 aa. Conserved hypothetical protein, highly similar to several conserved hypothetical proteins from various species e.g. O29399|AF0862 conserved hypothetical protein from Archaeoglobus fulgidus (482 aa), FASTA scores: opt: 1496, E(): 2.1e-80, (52.3% identity in 432 aa overlap) (has its N-terminus longer 30 aa); O27634|MTH1597 conserved protein from Methanothermobacter thermautotrophicus (488 aa), FASTA scores: opt: 1428, E(): 2.1e-76, (50.9% identity in 432 aa overlap); Q9YB37|APE1758 hypothetical 53.7 KDA protein APE1758 from Aeropyrum pernix (483 aa), FASTA scores: opt: 1422, E(): 4.6e-76, (49.3% identity in 432 aa overlap) (has its N-terminus longer 30 aa); etc. Equivalent to AAK47022 from Mycobacterium tuberculosis strain CDC1551 (432 aa). 3' part extended since first submission (+175 aa). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 and 90 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2957572 | 2958870 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2631|Rv2631
MQVVNVATLPGIVRASYAMPDVHWGYGFPIGGVAATDVDNDGVVSPGGVGFDISCGVRLLVGEGLDREELQPRLPAVMDRLDRAIPRGVGTAGVWRLPDRNTLQEVLTGGARFAVEQGHGVALDLERCEDGGVMTGADAAKISDRALQRGLGQIGSLGSGNHFLEVQAVDRVYDPVAAAPMGLAEGTVCVMIHTGSRGLGHQICTDHVRQMEQAMGRYGIAVPDRQLACVPVHSPDGQAYLAAMAAAANYGRANRQLLTEATRRVFADATGTPLDLLYDVSHNLAKIETHPIDGQLRSVCVHRKGATRSLPPHHHELPAELAAVGQPVLIPGTMGTASYVLAGVTGNPAFFSTAHGAGRVLSRHQAARHTSGEAIRASLAKRGIIVRGTSRRGIAEEKPEAYKDVDEVIEASHQSGLARKVARLVPLGCVKG
Bibliography
- Voskuil MI, Schnappinger D, Visconti KC, Harrell MI, Dolganov GM, Sherman DR and Schoolnik GK [2003]. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. Regulon
- Park HD et al. [2003]. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
