Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in transcriptional mechanism.
ProductPossible transcriptional regulatory protein (probably ArsR-family)
CommentsRv2640c, (MTCY441.10c), len: 119 aa. Possible transcriptional regulator, arsR family, highly similar to many e.g. Q9L1V5|SC4A9.07 putative ArsR-family transcriptional regulator from Streptomyces coelicolor (117 aa), FASTA scores: opt: 261, E(): 5.6e-10, (47.75% identity in 103 aa overlap); Q9X8X8|SCH35.28c putative transcriptional regulator from Streptomyces coelicolor (122 aa), FASTA scores: opt: 252, E(): 2.2e-09, (37.05% identity in 116 aa overlap); Q9L220|SC1A2.21 putative ArsR-family transcriptional from Streptomyces coelicolor (119 aa), FASTA scores: opt: 252, E(): 2.2e-09, (37.05% identity in 116 aa overlap); P77295|YGAV_ECOLI|B2667 hypothetical transcriptional regulator from Escherichia coli strain K12 (99 aa), FASTA scores: opt: 156, E(): 0.0023, (34.1% identity in 88 aa overlap); etc. Also similar to upstream ORF P71941|Rv2642|MTCY441.12 putative transcriptional regulatory protein from Mycobacterium tuberculosis (126 aa), FASTA scores: opt: 237, E(): 2e-08, (38.55% identity in 109 aa overlap). Contains helix-turn-helix motif at aa 59-80 (Score 1166, +3.16 SD). Belongs to the ArsR family of transcriptional regulators.
Functional categoryRegulatory proteins
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29654782965837-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2640c|Rv2640c
MPKSLPVIDISAPVCCAPVAAGPMSDGDALAVALRLKALADPARVKIMSYLFSSPAGEQVSGQLAAALSLSDGTVSHHLAQLRKAGLVISDRRGMHVFHRVHPEALQALCTVLNPNCCA