Gene Rv2641
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Cadmium inducible protein CadI |
| Comments | Rv2641, (MTCY441.11), len: 152 aa. CadI, conserved hypothetical protein. Gene induced by cadmium (see Hotter et al., 2001), highly similar to hypothetical proteins e.g. Q9L222|SC1A2.19c from Streptomyces coelicolor (152 aa), FASTA scores: opt: 509, E(): 2.3e-27, (55.05% identity in 149 aa overlap); P45945|YQCK_BACSU from Bacillus subtilis (146 aa), FASTA scores: opt: 295, E(): 5.4e-13, (33.55% identity in 146 aa overlap); and Q98CF8|MLL5167 from Rhizobium loti (Mesorhizobium loti) (124 aa), FASTA scores: opt: 110, E(): 1.3, (31.4% identity in 121 aa overlap). Some similarity with Q10548|Y887_MYCTU|Rv0887c|MT0910|MTCY31.15c from Mycobacterium tuberculosis (152 aa), FASTA scores: opt: 108, E(): 2.1, (25.7% identity in 148 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see proteomics citations). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2965939 | 2966397 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2641|cadI
MSRVQLALNVDDLEAAITFYSRLFNAEPAKRKPGYANFAIADPPLKLVLLENPGTGGTLNHLGVEVGSSNTVHAEIARLTEAGLVTEKEIGTTCCFATQDKVWVTGPGGERWEVYTVLADSETFGSGPRHNDTSDGEASMCCDGQVAVGASG
Bibliography
- Jungblut PR, Schaible UE, Mollenkopf HJ, Zimny-Arndt U, Raupach B, Mattow J, Halada P, Lamer S, Hagens K and Kaufmann SH [1999]. Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens. Proteomics
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Hotter GS et al. [2001]. Identification of a cadmium-induced gene in Mycobacterium bovis and Mycobacterium tuberculosis. Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant