Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductCadmium inducible protein CadI
CommentsRv2641, (MTCY441.11), len: 152 aa. CadI, conserved hypothetical protein. Gene induced by cadmium (see Hotter et al., 2001), highly similar to hypothetical proteins e.g. Q9L222|SC1A2.19c from Streptomyces coelicolor (152 aa), FASTA scores: opt: 509, E(): 2.3e-27, (55.05% identity in 149 aa overlap); P45945|YQCK_BACSU from Bacillus subtilis (146 aa), FASTA scores: opt: 295, E(): 5.4e-13, (33.55% identity in 146 aa overlap); and Q98CF8|MLL5167 from Rhizobium loti (Mesorhizobium loti) (124 aa), FASTA scores: opt: 110, E(): 1.3, (31.4% identity in 121 aa overlap). Some similarity with Q10548|Y887_MYCTU|Rv0887c|MT0910|MTCY31.15c from Mycobacterium tuberculosis (152 aa), FASTA scores: opt: 108, E(): 2.1, (25.7% identity in 148 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsIdentified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see proteomics citations).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29659392966397+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2641|cadI
MSRVQLALNVDDLEAAITFYSRLFNAEPAKRKPGYANFAIADPPLKLVLLENPGTGGTLNHLGVEVGSSNTVHAEIARLTEAGLVTEKEIGTTCCFATQDKVWVTGPGGERWEVYTVLADSETFGSGPRHNDTSDGEASMCCDGQVAVGASG
      
Bibliography