Gene Rv2643
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transport of arsenic compounds across the membrane (export): arsenic resistance by an export mechanism. Responsible for the translocation of the substrate across the membrane. |
| Product | Probable arsenic-transport integral membrane protein ArsC |
| Comments | Rv2643, (MTCY441.13), len: 498 aa. Probable arsC, arsenical resistance transport integral membrane protein, highly similar or similar to others e.g. Q9L1X4|SC3D9.05 possible arsenic resistance membrane transport protein from Streptomyces coelicolor (368 aa), FASTA scores: opt: 1729, E(): 2.2e-96, (74.3% identity in 358 aa overlap); Q9X8Y0|SCH35.26 putative heavy metal resistance membrane protein from Streptomyces coelicolor (369 aa), FASTA scores: opt: 1729, E(): 2.2e-96, (73.8% identity in 359 aa overlap); Q06598|ACR3_YEAST|ACR3|YPR201W|P9677.2 arsenical-resistance protein from Saccharomyces cerevisiae (Baker's yeast) (404 aa), FASTA scores: opt: 591, E(): 4e-28, (36.6% identity in 380 aa overlap); etc. Belongs to the ACR3 family. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2966910 | 2968406 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2643|arsC
MTETVTRTAAPAVVGKLSTLDRFLPVWIGSAMAAGLLLGRWIPGLHTALEGVQLDGISLPIALGLLIMMYPVLAKVRYDRLDTVTGDRKLLLSSLLLNWVLGPALMFALAWLLLADLPEYRTGLIIVGLARCIAMVIIWNDLACGDREAAAVLVALNSIFQVAMFAALGWFYLSVLPGWLGLEQTTIATSPWQIAKSVLIFLGIPLLAGYLSRRIGEKTKGRNWYESRFLPKVGPWALYGLLFTIVILFALQGDQITGRPLDVARIALPLLAYFAIMWVGGYLLGAALRLGYRRTTTLAFTAASNNFELAIAVAIATYGATSGQALAGVVGPLIEVPVLVGLVYVSLALRNRLAGPNATHDADKPSVLFVCVHNAGRSQMAAGLLTHLAGDRIEVRSAGTEPAGQVNPTAVAAMAEMGIDITANAPTLLTGGQVQSSDVVITMGCGDACPYFPGVSYRNWKLPDPAGQPLDVVRMIRDDIADRVQALIAELLATAKTR
Bibliography
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant