Gene Rv2692 (trkA, trkB)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Part of a potassium transport system. |
| Product | TRK system potassium uptake protein CeoC |
| Comments | Rv2692, (MTCY05A6.13), len: 220 aa. CeoC (alternate gene names: trkA and trkB), TRK system potassium uptake protein (see citation below), highly similar to others e.g. O54141|SC2E9.16c from Streptomyces coelicolor (226 aa), FASTA scores: opt: 870, E(): 9.4e-48, (58.8% identity in 216 aa overlap); Q58505|TRKA_METJA|MJ1105 from Methanococcus jannaschii (218 aa), FASTA scores: opt: 361, E(): 9.7e-16, (29.8% identity in 218 aa overlap); O27333|TRKA_METTH|MTH1265 from Methanobacterium thermoautotrophicum (216 aa), FASTA scores: opt: 326, E(): 1.5e-13, (30.1% identity in 216 aa overlap); etc. Also similar to downstream orf O07193|CEOB|TRKA|Rv2691|MTCY05A6.12 TRK system potassium uptake protein from Mycobacterium tuberculosis (227 aa), FASTA scores: opt: 259, E(): 2.6e-09, (26.55% identity in 226 aa overlap). Contains a motif common to NAD+ binding pockets (see citation below). Belongs to the TrkA family. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3010024 | 3010686 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2692|ceoC
MKVAVAGAGAVGRSVTRELVENGHDITLIERNPDHLDAAAIPEAHWRLGDACELSLLESIHLEEFDVVVAATGDDKVNVVLSLLAKTEFAVPRVVARVNDPRNEWLFNDAWGVDVAVSTPRMLASLIEEAVTIGDLVRLMEFRTGQANLVEITLPDNTPWGGKPVRKLQLPRDAALVTILRGPRVIVPEADEPLEGGDELLFVAVTEAEEELSRLLLPSM
Bibliography
- Chen P et al. [1998]. Novel selection for isoniazid (INH) resistance genes supports a role for NAD+-binding proteins in mycobacterial INH resistance. Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant